KEGG   Serratia plymuthica AS9: SerAS9_3177Help
Entry
SerAS9_3177       CDS       T01503                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
srr  Serratia plymuthica AS9
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:srr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:srr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:srr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3378917..3380224)
Genome map
AA seq 435 aa AA seqDB search
MIKVTFMGAGSTIFAKNVLGDIMATPALKEVDIALYDIDSARLNESFTMLSNINRNTNAG
RAKITPYLGVENRRAALKNANYVVNAIQVGGYDPCTITDFTIARKYGLQQTIADTLGIGG
IFRALRTIPVLFDFARDIEAVCPDAWLLNYTNPMAAITGAMLRHTEVKTVGLCHSVQVCA
ETLLKSVDMPTDDVQFHIAGINHMAWLLDVRRHGEDLYPEIKRRANALQGKHDDMVRHEI
MKTFGYYVTESSEHNAEYMPYWIKRNYPELIERFNIPLDEYPRRCIEQIEQWQQQKVALT
HDASLTHCRTHEYASYIIEAMETDRPYKIGGNVLNTGLITNLPAEACVEVPCLVDGQGIT
PCYVGNLPEQLAALNRTNINTQLLTIEAAVTHKREAIYHAALLDPHTSAELSIDDIRKLC
DELIEAHGNWLPAYH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagtgacatttatgggcgcgggcagcaccattttcgccaagaacgtactcggc
gacatcatggcgacgccggcattgaaagaggtggatattgcgctgtacgacatcgacagt
gcccgtctcaacgaatccttcaccatgttgagcaatatcaaccgcaataccaatgcgggc
agggcgaagattaccccttacctcggcgtagaaaaccgccgcgcggcattgaaaaacgcc
aattacgtggtgaatgccatccaggtcggcggctacgatccttgcaccatcaccgatttc
accattgccagaaaatacggcttgcagcagaccattgccgataccttgggtattggcggt
atcttccgtgcgctgcgcaccattccggtgttgtttgatttcgcccgggatatcgaagcg
gtctgcccggacgcctggctgctgaactataccaatccgatggcggcaataaccggcgcc
atgctgcgccataccgaagtgaaaacggtggggttgtgccacagcgttcaggtctgcgcc
gagacgctgctgaaaagcgtggatatgccgaccgacgacgtgcagttccacatcgcgggc
atcaaccatatggcctggctgctggacgttcgtcgtcacggcgaagacctgtacccggaa
atcaagcgtcgcgccaatgccttgcagggcaagcatgatgacatggtgcgccatgaaatc
atgaaaaccttcggctattacgtgaccgaatcttcagagcacaatgccgaatacatgcct
tattggatcaaacgcaattatccggaactgattgagcgcttcaatattccgctggatgaa
tacccgcgccggtgtattgagcaaattgaacagtggcagcaacagaaagtggcgctgacc
catgacgccagtctgactcattgccgcactcatgaatatgcttcttacatcatcgaagcg
atggagaccgatcggccctacaagattggcggcaatgtgctcaacaccgggttgatcacc
aacctgcctgcggaggcctgcgtcgaagtgccttgtctggtggatgggcaggggatcacg
ccatgctacgtcggcaacttgccggagcaattggcggcgctgaaccgcacgaatatcaat
acccaactgttgaccattgaagcggcggtcacgcacaaacgcgaggctatctaccatgcg
gcgctgctggatccgcacacctccgccgagctttcgatcgatgacatccgcaagctgtgc
gacgaactgattgaagcgcacggcaactggcttcccgcctaccattaa

DBGET integrated database retrieval system