KEGG   Serratia plymuthica AS9: SerAS9_3493Help
Entry
SerAS9_3493       CDS       T01503                                 

Definition
NAD(P)H-quinone oxidoreductase subunit 2 (EC:1.6.99.5)
Orthology
K00343  
NADH-quinone oxidoreductase subunit N [EC:1.6.5.3]
Organism
srr  Serratia plymuthica AS9
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:srr00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3726558..3728015)
Genome map
AA seq 485 aa AA seqDB search
MTITPQQLIALLPLLIVGLTVVVVMLGIAWRRDHFINATLTVIGLNLALLSLYFVGQAGP
MDVTPLLRVDGYSMFYTGLVILASLATCTFAYPWLVGYPDNREEFYLLVLIATLGGIVLA
SANHLASLFIGIELISLPLFGLVGYAYRQKRPLEAAIKYMLLSAAASSFLLFGMALLYAE
SGDLSLAGLGKSLHENMMHQPLILAGMGMMIVGLGFKLSLVPFQLWTPDVYQGAPAPVST
FLATASKIAIFAVVMRLFLYAPAADSEALRMVLSIIAVCSILFGNLMAISQTNIKRLLGY
SSIAHLGYLLVALIAVQTHQLSLETAGVYLAGYLFSSLGAFGVVSLMSSPYRGPDADSLF
SYRGLFWHKPILSAVMTVMMLSLAGIPMTLGFIGKFFVIAMGVSAHLWWLTGAVVLGSAI
GLYYYLRVTVSLFLSAPEALQRDTPNNWALTAGGVVVLISAALVLLLGVYPQPLITLVQM
AQPMF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacaataactcctcaacaactgatcgcactgctaccgctgttgatcgtcggattgacg
gtggtggttgtgatgctaggcattgcgtggcgacgcgaccactttatcaacgccacgctg
accgtgatcggtctaaacctggcgctgctttcgctgtattttgttggccaggcaggccca
atggacgtcaccccgctgctgcgggttgacggctactcgatgttctataccgggctggtg
atactggcgagtctggcgacctgtaccttcgcttatccatggctggtgggttacccggac
aaccgcgaagagttctacctgctggtgctgattgccacgctgggtggcattgtgctggcg
agcgccaaccacctggcgtcgctgttcatcggtattgaactgatctcgctgccgctgttc
ggcctggtgggctatgcctaccgccagaagcgtccgttggaagccgctatcaagtacatg
ctgctgtccgctgcggcttcgtcattcctgctgttcggtatggcgctgctgtatgccgag
tccggtgatctgtcgctggccggtctgggcaagagcctgcacgaaaacatgatgcaccaa
ccgctgatcctggccggtatgggcatgatgattgtgggtctgggcttcaagctgtctctg
gtgccgttccaactgtggacgccggatgtgtatcagggggcgcctgcgccggtctctacc
ttcctggccactgccagcaagattgcgatcttcgccgtagtgatgcgtctgttcctgtat
gccccggccgccgacagcgaagcgctgcgtatggtgttgtcgatcattgccgtctgttca
attctgttcggcaacctgatggctatcagccagaccaacatcaagcgtctgctgggttac
tcgtcgatcgcccacctgggttatctgctggtggcgctgattgcggtgcaaacccatcaa
ctgtcgctggaaaccgccggtgtctacctggccggttacctgttcagcagcctgggcgcg
ttcggtgtggtcagcctgatgtccagcccgtaccgtggcccggacgccgattcactgttc
tcctaccgtggtctgttctggcataagccgattctttccgcggtcatgacggtgatgatg
ctgtctctggccggtatcccgatgaccctgggctttatcggtaagttcttcgttatcgcg
atgggcgtcagcgctcacctgtggtggctgaccggtgctgtggtactgggcagtgccatc
ggtttgtactactacctgcgtgtgaccgtcagcctgttcctcagcgcgccggaagctctg
caacgcgatacgccgaacaactgggcgttgactgcgggcggtgtggtcgtgctgatctcc
gctgcgttggtgttgctgttgggtgtctacccacagccgctgattacgctggtgcagatg
gcgcagccgatgttctga

DBGET integrated database retrieval system