KEGG   Serratia plymuthica AS9: SerAS9_3600Help
Entry
SerAS9_3600       CDS       T01503                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00010  Glycolysis / Gluconeogenesis
srr00052  Galactose metabolism
srr00500  Starch and sucrose metabolism
srr00520  Amino sugar and nucleotide sugar metabolism
srr00521  Streptomycin biosynthesis
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01120  Microbial metabolism in diverse environments
srr01130  Biosynthesis of antibiotics
srr01200  Carbon metabolism
Module
srr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
srr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS9_3600
   00052 Galactose metabolism
    SerAS9_3600
   00500 Starch and sucrose metabolism
    SerAS9_3600
   00520 Amino sugar and nucleotide sugar metabolism
    SerAS9_3600
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SerAS9_3600
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SerAS9_3600
Enzymes [BR:srr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SerAS9_3600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AEF46709
JGI: SerAS9_3600
Position
complement(3836522..3837484)
Genome map
AA seq 320 aa AA seqDB search
MTYALVGDVGGTNARLALCTVATGEITQAKTYSGLEFDSLEAVIRHYLKEQDIQVQDACI
AIACPVTEDWVAMTNHTWAFSIKEMQANLGLSHLEVINDFTAVSMAIPMLTPDDVLQFGG
GSAQKDRPIAVYGAGTGLGVAHLVHVNRRWVSLPGEGGHVDFAPNSEEEDSILEVLRAEV
GHVSAERVLSGPGLVNLYRAIVKSDQRLPEKLEPKDITERALADSCIDCRRALSLFCVIL
GRFGGNLALNLGTFGGVYIAGGIVPRFMEFFKASGFRAAFEDKGRFKDYVHDIPVFMITH
AQPGLLGAGAHLRQTLGMHL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacctatgccctcgtaggtgatgttggcgggacgaatgcccgcctggcgttgtgcact
gtggcgacgggtgaaattacccaggcaaaaacctattccggcctggagtttgacagcctg
gaggcggtgatccgccactatctgaaggagcaggatattcaggtgcaggacgcctgcatc
gcgattgcctgtccggtcaccgaagattgggtggcgatgaccaaccacacctgggcgttc
tcgatcaaagagatgcaagccaatctggggcttagccatctggaagtgatcaacgacttt
accgccgtctcgatggcgatcccgatgttgacgccagacgatgtgttgcagttcggcggc
ggcagcgcgcagaaagacaggccgattgcggtgtacggcgcaggcaccggcctgggggtg
gcgcacctggtgcacgttaaccgccgctgggtgagcttgccgggggaaggcggccacgtt
gattttgcgccgaacagcgaagaggaagatagcattcttgaggtgctgcgggcagaagtg
gggcacgtctccgccgagcgcgtgttgtccggcccggggttggtcaatctctaccgcgct
atcgtcaagtccgatcaacgcctgccggaaaagctcgagccaaaggacatcaccgagcgc
gcgctggccgacagttgcattgactgccgccgtgccttgtcgctgttctgcgttatttta
gggcgctttggcggcaacctggcgttgaatctcggcactttcggcggcgtttacatcgcc
ggcggcatcgtgccgcgctttatggagttcttcaaggcatccggtttccgcgcggcgttt
gaagataaagggcgtttcaaggattatgtgcatgatatcccggtctttatgatcacccat
gcacaaccgggcttgttgggcgccggtgcccatctgcgccagacgctgggtatgcatttg
taa

DBGET integrated database retrieval system