KEGG   Serratia plymuthica AS9: SerAS9_3691Help
Entry
SerAS9_3691       CDS       T01503                                 

Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00300  Lysine biosynthesis
srr01100  Metabolic pathways
srr01120  Microbial metabolism in diverse environments
srr01230  Biosynthesis of amino acids
Module
srr_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SerAS9_3691
Enzymes [BR:srr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SerAS9_3691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AEF46800
JGI: SerAS9_3691
Position
3941287..3942414
Genome map
AA seq 375 aa AA seqDB search
MICPVIELAQQLIKRPSLSPHDEGCQALMIERLEAIGFTVEPMHFGDTLNFWAWRGEGQT
LAFAGHTDVVPTGDEKRWDNPPFEPTIRDGMLYGRGAADMKGSLAAMVVAAERFVAANPY
HQGRLAFLITSDEEASATHGTVKVVEALMARNERLDYCLVGEPSSTERVGDVVKNGRRGS
ITANLHIHGIQGHVAYPHLADNPVHRAMPALNELVATEWDRGNEFFPPTSMQIANVQAGT
GSNNVIPGDLFVQFNFRFSTESTDATIKQRVEELLERHQLNYSIEWRLSGQPFLTARGAL
VDAVVNAVEHYSELTPQLLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVHAADLQ
LLSRMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcccggttatcgaactggctcaacagctcatcaaacgcccgtccctcagcccg
cacgatgaaggctgccaggcgctgatgattgaacgtctggaagcgattggttttaccgtt
gagccgatgcacttcggcgacaccctgaacttctgggcctggcgcggcgaagggcaaacg
ctggcgtttgccggccacaccgacgtggtgccgaccggcgatgaaaaacgctgggacaac
ccgccgtttgaacccaccattcgcgacggcatgctgtatggccgcggcgcggcggacatg
aaaggttcgctggcggcgatggtggtggcggcggagcgctttgtggcggccaacccgtac
catcagggccgcctggcgttcctgatcacctccgacgaagaggccagtgccactcacggc
acggtgaaagtggtagaagcgctgatggcgcgcaacgagcgcctggattattgcctggtc
ggcgagccgtccagcaccgaacgcgtcggcgacgtggtgaaaaacggccgccgcggttcg
atcaccgctaacctgcacattcacggcattcaaggccacgtcgcctatccgcacctggcg
gataaccctgtgcatcgcgccatgcctgcgctcaatgagttggtggcgaccgaatgggat
cgcggcaatgaattcttcccaccgaccagcatgcagatcgccaacgtgcaggccggtacc
ggcagcaacaacgtgatcccgggcgacctgttcgtccagttcaacttccgtttcagcacc
gagtcaaccgacgcgacgataaaacagcgcgtggaagagttgctggagcggcatcagctg
aactacagcatcgaatggcgtttgtccggccagccgttcctgaccgcgcgcggtgcgctg
gtggacgcggtggttaatgccgtcgaacactattctgaactgacgccgcagttgctgacc
actggcggtacctcagacggccgctttatcgcccaaatgggggcgcaggtggtcgagctg
gggccggtcaacgcgaccatccacaaggtcaatgaatgcgtgcacgccgccgatttgcag
ctgctgagccgcatgtatcagcgcatcatggagcagttggtcgcatga

DBGET integrated database retrieval system