KEGG   Serratia plymuthica AS9: SerAS9_3691Help
Entry
SerAS9_3691       CDS       T01503                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
srr  Serratia plymuthica AS9
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:srr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:srr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3941287..3942414
Genome map
AA seq 375 aa AA seqDB search
MICPVIELAQQLIKRPSLSPHDEGCQALMIERLEAIGFTVEPMHFGDTLNFWAWRGEGQT
LAFAGHTDVVPTGDEKRWDNPPFEPTIRDGMLYGRGAADMKGSLAAMVVAAERFVAANPY
HQGRLAFLITSDEEASATHGTVKVVEALMARNERLDYCLVGEPSSTERVGDVVKNGRRGS
ITANLHIHGIQGHVAYPHLADNPVHRAMPALNELVATEWDRGNEFFPPTSMQIANVQAGT
GSNNVIPGDLFVQFNFRFSTESTDATIKQRVEELLERHQLNYSIEWRLSGQPFLTARGAL
VDAVVNAVEHYSELTPQLLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVHAADLQ
LLSRMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcccggttatcgaactggctcaacagctcatcaaacgcccgtccctcagcccg
cacgatgaaggctgccaggcgctgatgattgaacgtctggaagcgattggttttaccgtt
gagccgatgcacttcggcgacaccctgaacttctgggcctggcgcggcgaagggcaaacg
ctggcgtttgccggccacaccgacgtggtgccgaccggcgatgaaaaacgctgggacaac
ccgccgtttgaacccaccattcgcgacggcatgctgtatggccgcggcgcggcggacatg
aaaggttcgctggcggcgatggtggtggcggcggagcgctttgtggcggccaacccgtac
catcagggccgcctggcgttcctgatcacctccgacgaagaggccagtgccactcacggc
acggtgaaagtggtagaagcgctgatggcgcgcaacgagcgcctggattattgcctggtc
ggcgagccgtccagcaccgaacgcgtcggcgacgtggtgaaaaacggccgccgcggttcg
atcaccgctaacctgcacattcacggcattcaaggccacgtcgcctatccgcacctggcg
gataaccctgtgcatcgcgccatgcctgcgctcaatgagttggtggcgaccgaatgggat
cgcggcaatgaattcttcccaccgaccagcatgcagatcgccaacgtgcaggccggtacc
ggcagcaacaacgtgatcccgggcgacctgttcgtccagttcaacttccgtttcagcacc
gagtcaaccgacgcgacgataaaacagcgcgtggaagagttgctggagcggcatcagctg
aactacagcatcgaatggcgtttgtccggccagccgttcctgaccgcgcgcggtgcgctg
gtggacgcggtggttaatgccgtcgaacactattctgaactgacgccgcagttgctgacc
actggcggtacctcagacggccgctttatcgcccaaatgggggcgcaggtggtcgagctg
gggccggtcaacgcgaccatccacaaggtcaatgaatgcgtgcacgccgccgatttgcag
ctgctgagccgcatgtatcagcgcatcatggagcagttggtcgcatga

DBGET integrated database retrieval system