KEGG   Serratia plymuthica AS9: SerAS9_4195Help
Entry
SerAS9_4195       CDS       T01503                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
srr  Serratia plymuthica AS9
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:srr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4488748..4489248
Genome map
AA seq 166 aa AA seqDB search
MIRVYIALGSNLAQPLQQVKAALEALEHLPRTRLILCSSFYRTKPLGPQNQPDFLNAVVA
LDTLLPAEQLLDHTQAIERNQGRVRKDERWGPRTLDLDIMLYGEQVIHTDRLTVPHYGLK
EREFMLYPLAEIAPELVFPDGESLASCLKRVPENGMELWHQPKQKA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgtttatatcgcgctggggagtaacctggcgcaaccgctgcaacaggtaaaa
gccgcactggaggcgctggagcatctcccgcgcacccgattgatcctttgttcgtcgttt
taccgcaccaagccgctggggccgcagaaccagccggactttctcaatgcggtggtggcg
ctcgataccttgctgcccgccgaacaactgctcgatcatacccaagcgatagaacgcaat
cagggccgcgtgcgcaaagatgagcgctggggcccgcgcaccctcgatctggacatcatg
ctgtatggcgagcaggttattcataccgatcgcctgacagtgccgcattacggcctgaaa
gaacgcgagttcatgctctacccgctggcggaaatcgcccccgaattggtgttcccggac
ggcgagtcgttggccagttgcctgaagcgcgtgccggagaacggcatggaactttggcat
cagcccaagcaaaaagcctga

DBGET integrated database retrieval system