KEGG   Serratia plymuthica AS9: SerAS9_4350Help
Entry
SerAS9_4350       CDS       T01503                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
srr  Serratia plymuthica AS9
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SerAS9_4350
   00500 Starch and sucrose metabolism
    SerAS9_4350
Enzymes [BR:srr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SerAS9_4350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
4694135..4695544
Genome map
AA seq 469 aa AA seqDB search
MEELNLMKQAVQALMTGMPLALRDPHRPAWHLAPSVGLLNDPNGFIQHKGVYHLFYQWNP
LGCDHRNKCWGHWQSTDLLNWQHQPVALVPGACYDSHGCYSGSAVVADGKIMLAYTGNVK
YPDGSRTAYQCLALENAQGGYDKLGPVLPLPEGYSGHVRDPKVWRHQDSWYMVLGARDLQ
DRGKVLLLRSADLRSWQLLGEIAGTQLNGMGDFGYMWECPDLFTLAGAEVLICCPQGLAA
QDERYLNVYQAGYLTGKLDYRQAAFEHGEFHELDAGFEFYAPQTTLAEDGRRLLVGWMGV
PEQDEACHPTLQYGWIHTMTCPRELSLQNGKLYQQPARELQRLRGEGSQWQGMAGNAPVW
PVDSAEVLLTPNGAFSADFGDAMTLSWDGALLRLTRNNLRNGQPEHRYWRGEVTHLQMLF
DSSSVEIFINHGEGVMSSRYFPGPQPLLRLSGETQLALEHWPLTPCMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactgaatttgatgaaacaggccgttcaggcgctgatgacgggtatgccgctg
gcgctgcgcgatcctcatcgcccggcatggcatctggcccccagcgtcggcctgctgaac
gaccccaacgggtttattcagcataagggggtttatcatctgttctatcagtggaacccg
ctgggctgcgatcaccgcaacaaatgctggggccattggcaatcgacggatctgctcaac
tggcagcatcagccggtggcgctggtgcccggcgcttgttacgacagccacggctgttac
tcaggctcggcggtggtggcagacggcaaaatcatgctggcgtataccggcaacgtaaaa
taccccgacggttctcgcaccgcgtaccagtgcctggcgctggaaaatgcgcagggcggg
tatgacaagctcggcccggtgctgccgctgccggaaggctacagcggccacgtgcgcgat
cccaaggtttggcgccaccaagacagctggtacatggtgctcggcgcccgtgacctgcag
gatcgcggcaaggtgctgttgctgcgctccgccgatctgcgcagttggcagctgttgggg
gaaattgccggcacacagctgaacggcatgggcgatttcggctatatgtgggaatgcccg
gacctgttcacgctggcgggtgccgaggtgttgatttgttgcccgcaggggctggcggcg
caggatgaacgttatctcaacgtttaccaggcgggctatctgaccggcaagctggattat
cgacaggcggcctttgaacatggcgaattccacgagctggacgccgggttcgaattctat
gcgccgcaaaccacgctggccgaagacggccgccgcctgctggtcggctggatgggcgta
ccggagcaggacgaagcctgtcacccgacgttgcaatacggctggatccataccatgacc
tgcccgcgcgaactttctttgcagaacggcaagctttaccagcagccggcgcgcgagctg
caacggctgcgcggcgagggcagccaatggcagggaatggcgggtaacgcccctgtctgg
ccggtcgacagtgccgaagtgttgttgacgcccaacggcgcattcagcgccgactttggc
gatgcgatgacgctgagctgggacggcgccttgctgcgtctgacgcgcaacaacctgcgc
aacgggcagcctgaacaccgttactggcgcggtgaggtcacccatctgcaaatgctgttc
gacagctccagcgtggagatttttatcaaccacggcgaaggggtcatgagctcacgctac
ttccctggcccgcaaccgttgctgcgtttgagcggtgagacgcagcttgcactggagcac
tggccgctgacgccatgcatgctagaatga

DBGET integrated database retrieval system