KEGG   Serratia plymuthica AS9: SerAS9_4600Help
Entry
SerAS9_4600       CDS       T01503                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
srr  Serratia plymuthica AS9
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SerAS9_4600
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SerAS9_4600
   00630 Glyoxylate and dicarboxylate metabolism
    SerAS9_4600
Enzymes [BR:srr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SerAS9_4600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(4980612..4982210)
Genome map
AA seq 532 aa AA seqDB search
MTQQIVGTELTFTQGFTAAERQVLTDDAVEFLAELVGKFTPQRNKLLAARACWQQKIDQG
DLPGFISETTSIREGEWKILGIPDDLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWDKVIEGQINLHDAVNGTISYTNEAGKIYQLKPNPAVLIARVRGLHLPEKHVQWQG
EAIPGGLFDFALYFFHNYRQLLEKGSGPYFYLPKTQSWQEAAWWSEVFSFTEDRFDLPRG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHADRVLPDRQSV
TMDKSFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAEKNAWVLNKVRADKELEANNGH
DGTWVAHPGLADTVMEVFSRVLGERRNQLEVLRENDAPISAAQLLEPCDGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKSLSDGQLVTKALFRQ
MLAEEVLVIQEELGEQRFSHGRFTEAARLMEKITVSDELIDFLTLPGYELLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacagatagtaggcacggagttaacgtttacgcagggttttaccgctgctgag
cgacaggtgttaacggatgacgcggtcgaattcctggcggaactggtgggtaaatttact
ccacagcgcaacaagctattggctgcgcgcgcctgctggcagcagaagatcgatcaaggc
gatcttccagggtttatttcggaaacaacttccattcgtgaaggtgagtggaagatcctg
ggtattcccgatgatctgcgcgaccgcagggtagaaatcaccgggccggttgaacgcaag
atggtaatcaatgccttgaacgccaatgtgaaggtgtttatggctgatttcgaagactcg
cttgcacctagctgggacaaagtgatcgaggggcaaatcaacctgcatgatgcggtgaac
ggcaccatctcctataccaacgaagccggaaagatttatcagttgaagccgaacccggca
gtattgatcgcccgtgtgcgtggtctgcatctgccggagaaacacgtgcagtggcagggg
gaagcgatccccggcggcctgtttgatttcgcactgtatttctttcacaactaccgccaa
ctgctggaaaaaggcagcggcccttacttctatctgccgaaaacccagtcctggcaggaa
gcggcctggtggagcgaggtattcagctttaccgaggatcgttttgatttgccgcgcggc
accatcaaagccacggtactgatcgaaaccttgccggcggtcttccagatggatgagatc
ctgtatcacctgcgcgatcatatcgtcgggttgaactgcggtcgttgggattacatcttc
agctacatcaaaacgctgaaaaaccatgctgaccgggtgttgccggatcgtcagtcggtc
acgatggacaaatcgttcctcagcgcctattcccgcttgctgatcaaaacctgccataaa
cgtggcgccttcgcgatgggcggcatggcggcgtttattccgagcaaagatgccgagaaa
aacgcctgggtgctgaacaaggtgcgggcggataaagagctggaggccaataacggccac
gacggcacctgggtggcgcacccagggctggcggacaccgtgatggaggtgttcagccgg
gtactcggcgagcgccgcaatcagctggaagtgctgcgtgaaaacgatgcgccgatcagt
gccgcgcaactcctggagccttgcgacggcgagcggaccgaagccggtatgcgtgccaac
attcgcgtggcggtgcaatacatcgaggcctggatctccggcaacggctgcgtaccgatt
tacgggctgatggaggatgcggcgacggcagaaatttcccgtacctcgatctggcagtgg
atccaccatgaaaaatccctcagcgacggccaattggtcaccaaagcgctgttccgtcag
atgcttgccgaagaagttctcgttattcaagaagaactcggcgagcaacgtttcagccac
gggcgttttaccgaggccgcgcgtctgatggagaaaatcaccgtttcagatgagctgatc
gatttcctgacattgcccggctacgaattactggcctga

DBGET integrated database retrieval system