KEGG   Serratia plymuthica AS9: SerAS9_4723Help
Entry
SerAS9_4723       CDS       T01503                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
srr  Serratia plymuthica AS9
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SerAS9_4723
Enzymes [BR:srr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SerAS9_4723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5091553..5093643)
Genome map
AA seq 696 aa AA seqDB search
MDRKRIDQAAAQAGIAADYINAHGKQQAIAEETKRKLLEAMGRSAAPLEAAVTPLPEVKV
FYQGAPVALPLAGSGEYLWTLLREDGGRQQGRASARKTLTLPGELPAGYHQLTLTQDERQ
WQCRLIVAPKRCFEPDALLTGQKLWGACVQLYTLRSDRNWGIGDFGDLRQMVEQVGERGG
AFVGLNPIHALYPANPESASPYSPSSRRWLNVVYIDVNAVEEFQRSDAAQKWWLKPATQK
QLTKARSSEQVDYSTVTQLKLAALKLAFPLFQGRKAGDEQRQAFEQFVVDGGASLYQQAA
FDALHAHLAAADGSLWGWPAWPEQYRQGDSAAVKQFCRQQQDSVTFYLWLQWLAASQFAD
CFRLSQQQQMPIGLYRDLAVGVAEGGSETWCEPDLYCLKASVGAPPDILGPLGQNWGLPP
MDPHVMAARGYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGETADHGAYVKYPVDD
LLAVLALESQRHRCMVIGEDLGTVPVEIVAKLRDSGVYSYKVLYFERDGENHFRAPQAYP
VQAMATITTHDLPTLRGYWQSGDLQLGNQLGLYPDAEILKALFADRERAKQGLLDGLHHY
GCVPQKVGKKAALLNMSPLLNRGLQRYVADSASALLGLQPEDWLDMAEPVNIPGTSDQYP
NWRRKLNKTLEEMFADQQVNRLLKDLDKRRRKVSVG
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcaagcgcatcgatcaggcggccgctcaggcgggtattgccgctgattatatt
aacgctcatgggaaacagcaggcgatcgcggaggagaccaagcgcaagctgctggaggcc
atggggcggagtgccgcaccgctggaggctgcggtgacgccgctgccggaggtcaaggtg
ttctatcagggcgcgccggtggcgttgccgcttgcgggcagcggcgagtatctctggact
ctgctgcgtgaagacggtggccggcaacaggggcgcgccagcgcgcgtaaaacccttacc
ctgccgggcgagttgccggcgggttatcaccaactgacgctgacccaggacgaacggcag
tggcagtgccggttgattgttgcgccgaaacgctgctttgagccggacgcgctgctgacc
ggacaaaagctgtggggcgcttgcgtccagctttacaccctgcgctccgatcgtaactgg
ggtatcggcgattttggcgatctgcggcagatggtggagcaggttggagaacggggaggc
gcttttgtcgggctgaacccgatccacgcgctgtatccggcgaacccggaaagcgccagc
ccgtacagcccgtcatcgcgacgctggctgaacgtggtgtatatcgatgtgaacgcggtg
gaagagttccagcgtagcgatgcggcgcaaaaatggtggctgaaaccggccacgcaaaaa
cagctgaccaaagcgcgcagcagcgaacaggtggattacagcacggtgacgcagctcaag
ctggcggcgctgaagctggcgttcccgttgttccaggggcgtaaagccggtgacgaacag
cgtcaggcgttcgagcagttcgttgtcgacggtggcgccagtctgtatcagcaggcggca
tttgacgcattgcatgctcatcttgccgccgctgacggcagcctgtggggttggccggcc
tggcctgagcaatatcggcagggcgacagcgccgcagtgaagcagttttgccggcaacag
caggattcggtgaccttctatctgtggttgcagtggttggccgccagccagtttgccgac
tgtttccgcctgagccaacaacagcaaatgccgattggcctgtaccgtgatttggcggtg
ggcgtggcggaaggcggttcggaaacctggtgcgagccggatctttattgcctgaaagcg
tcggttggcgcgccgccggacattctgggcccgctgggacaaaactgggggctgccgccg
atggatccgcacgtgatggcggcgcggggttaccagccgtttatcgacctgttgcgcgcc
aatatgaccagttgcggtgcgctgcgcattgaccacgtaatggcgctgctgcgcctgtgg
tggatcccctacggcgaaaccgccgaccatggcgcttacgtgaaatacccggtggatgac
ctgttggcggtgttggcgctggagagccagcgtcaccgctgtatggtgattggcgaagac
ctcggtaccgtgccggtcgagattgtcgccaagctgcgtgacagcggcgtctattcttat
aaggtgctgtatttcgagcgtgacggcgagaaccacttccgtgcgccgcaggcctacccg
gtgcaggcgatggcgaccatcaccacgcatgacctgccgacgctgcgcggttattggcag
agcggcgatctgcagctgggcaaccagctggggctgtatccggatgcggagatcctgaaa
gcattgtttgccgatcgtgaacgcgccaagcaggggttgctggacggattgcatcattat
ggctgtgtgccgcagaaggtgggcaagaaggcggcgttgctgaacatgagcccgctgctg
aaccgtggcttacagcgctatgttgccgacagcgccagcgcactgctgggcctgcagccg
gaagactggctggacatggcagaaccggtcaatattcccggcaccagcgatcagtaccca
aactggcggcgtaaactgaacaaaacgcttgaggagatgtttgccgatcagcaagttaac
cggctgctgaaggatttggacaagcggcggcgcaaggtgtcggtagggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system