KEGG   Serratia plymuthica AS9: SerAS9_4776Help
Entry
SerAS9_4776       CDS       T01503                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
srr  Serratia plymuthica AS9
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SerAS9_4776
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SerAS9_4776
Enzymes [BR:srr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SerAS9_4776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5155807..5156712)
Genome map
AA seq 301 aa AA seqDB search
MHIILAPTNLGLSPLRPGHVPGTWRAPQALMAQGLAQRLGAGAVTELPQLIYSPAAQPGT
RIRNGHAIRAFTLALAAEVAAAQAHGEFPLVVGGDCSILLGALAGSRSAGPLSLVHIDGH
SDFRHPGNYDPQQMLGAVAGMDLALATGRGEPLLTEWPGVAGPLVPERQVLQLGERECRD
ADFAWPDINQTAIARIDVFAANRMGKAEIVRQIEQMLATEPEWRFWLHLDVDVLDQTIMP
AVDSPGGPGIDRLWLENIVARLLQNPLCCGMTLSVFDPELDPDGRYAALIVEMLEAMFRS
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcattcttgcacctaccaatctggggctgagccccttgcgaccgggccatgtt
cccggaacctggcgagcgccgcaggcgctgatggcacagggtttggcgcaaaggttggga
gcgggggccgtcaccgagttgccgcaactgatctattcgccggcagcgcagcccggtacc
cgcatacgtaatggtcatgcgattcgcgccttcactctcgcgttggccgcagaggttgct
gcggcgcaggcgcacggcgagttcccgctggtggtcggcggcgattgttcgattctgctg
ggggcgctagccggttcacgcagtgcggggccgctttcgctggtacacatcgacgggcac
agcgatttccgtcatcccggcaactatgatccgcagcagatgttgggtgcggtggcgggg
atggatttggcgttggcgaccgggcgcggggaaccgctgctgaccgaatggcctggcgta
gcagggccgttggtgccggagcggcaggttttacagctgggcgagcgtgagtgccgggac
gcggattttgcctggccggatatcaatcaaacggcaattgcgcgcattgacgtcttcgcc
gccaaccggatgggcaaagcggaaattgtgcggcaaatcgaacagatgctggccaccgag
ccggaatggcgcttttggctgcatctggatgtggacgtgctcgatcaaaccattatgccg
gcggtggattcccccggtggccccggaatcgatcgcctctggctggaaaatatcgtggcg
cggttgctgcaaaatccgttgtgctgcggcatgacgctgtcggtattcgaccccgagctc
gatcccgacggccggtacgcggcgctgatagtggaaatgctggaggcgatgttccgctcc
cgctga

DBGET integrated database retrieval system