KEGG   Serratia plymuthica AS9: SerAS9_4894Help
Entry
SerAS9_4894       CDS       T01503                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
srr  Serratia plymuthica AS9
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SerAS9_4894
Enzymes [BR:srr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SerAS9_4894
Exosome [BR:srr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SerAS9_4894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5300131..5301639
Genome map
AA seq 502 aa AA seqDB search
MTVEKKYIVALDQGTTSSRAVVLDHDANIVAVSQREFTQIYPKAGWVEHDPMEIWSSQSS
TLVEVLAKADINSDQIAGIGITNQRETTIVWEKETGKPIYNAIVWQCRRTADICEKLKRD
GLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARERAKRGELLFGTVDTWLVWKMTQGRV
HVTDYTNASRTMMFNIHELDWDDRMLEALDIPRVMLPKVRPSSEVYGQTNIGGKGGTRIP
IAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFLLMNTGKEAVRSNHGLLTTIACGPRGEV
NYALEGAVFIGGASIQWLRDELKLISDAADSEYFATKVKDSNGVYVVPAFTGLGAPYWDP
YARGAIFGLTRGANSNHIIRATLESIAYQTRDVLDAMQADSNTRLQSLRVDGGAVANNFL
MQFQSDILGTRVERPEVRESTALGAAFLAGLAIGYWNDLDEVKSKAVIEREFRPSIETTE
RNFRYSGWKKAVARAQAWEDHD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacagtagaaaaaaaatacattgtcgctctcgaccagggaaccaccagttcacgtgcc
gtagtgctcgatcacgatgccaatattgttgcggtatctcagcgcgagttcacgcagatt
tacccgaaagccggctgggttgaacacgatccgatggagatctggtcgtcacaaagctcc
acgctggtggaagtgctggcaaaagccgacatcaattccgatcagattgccggcatcggc
atcaccaaccagcgtgaaaccaccatcgtctgggaaaaagagaccggcaagccgatttac
aacgccatcgtctggcaatgtcgccgcaccgccgacatctgcgaaaagctcaagcgcgat
ggcctggaagagtacattcgtcacaacaccggcctggtggttgacccgtacttctccggc
accaaggtgaagtggatcctcgataacgttgaaggtgcccgtgaacgcgccaagcgcggc
gaactgctgttcggtaccgtcgacacctggctggtgtggaaaatgacccagggacgggtg
catgtgaccgattacaccaacgcctcgcgcaccatgatgtttaacatccatgagctggac
tgggacgatcgcatgctggaagcgttggatattccacgcgtcatgctgccgaaagtccgc
ccgtcctctgaggtgtacggccagaccaatatcggcggtaaaggcggcacgcgtattcct
atcgccggtatcgccggtgaccagcaggcggcgctgtacggccaactgtgcgttcaaccg
ggtatggcgaagaacacctatggcaccggctgcttcctgctgatgaacaccggcaaagaa
gcggtacgttccaaccacggcctgctgaccaccatcgcctgcggcccgcgcggtgaagtg
aactatgcgctggaaggcgcggtatttatcggcggtgcctccatccagtggctacgcgat
gagttgaaactgatcagcgatgcggccgactccgaatacttcgccaccaaggtgaaagac
agcaacggcgtctacgtagtaccggccttcaccggcctgggtgccccttactgggaccca
tatgcccgtggcgctatcttcggcctgactcgtggtgcgaacagcaaccacatcatccga
gccacgctggagtccatcgcctaccagacgcgcgacgtgctcgacgccatgcaggccgac
tccaacacccgcctgcagtcgctgcgtgtggacggtggcgcagttgccaacaacttcctg
atgcagttccagtccgacattctcggtacccgtgtggagcgtcctgaagtgcgcgaatcg
acggctctgggtgcagccttcctggcgggcctggccattggctactggaacgatctggat
gaggtgaagagcaaagccgttatcgagcgtgagttccgcccaagcattgaaaccaccgag
cgtaacttccgctacagcggatggaaaaaagcggtagcccgcgcccaggcatgggaagat
cacgactaa

DBGET integrated database retrieval system