KEGG   Serratia plymuthica AS9: SerAS9_4903Help
Entry
SerAS9_4903       CDS       T01503                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00010  Glycolysis / Gluconeogenesis
srr00030  Pentose phosphate pathway
srr00051  Fructose and mannose metabolism
srr00052  Galactose metabolism
srr00680  Methane metabolism
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01120  Microbial metabolism in diverse environments
srr01130  Biosynthesis of antibiotics
srr01200  Carbon metabolism
srr01230  Biosynthesis of amino acids
srr03018  RNA degradation
Module
srr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS9_4903
   00030 Pentose phosphate pathway
    SerAS9_4903
   00051 Fructose and mannose metabolism
    SerAS9_4903
   00052 Galactose metabolism
    SerAS9_4903
  Energy metabolism
   00680 Methane metabolism
    SerAS9_4903
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SerAS9_4903
Enzymes [BR:srr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SerAS9_4903
Protein phosphatases and associated proteins [BR:srr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SerAS9_4903
Messenger RNA biogenesis [BR:srr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SerAS9_4903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEF47996
JGI: SerAS9_4903
Position
complement(5309025..5309987)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDSPGMNAAIRGVVRAALSEGLEVFGIYDGYLGLYEDRMERLDRYSVSD
MINRGGTFLGSARFPEFRDDSVRAKAIENLKNRGIDALVVIGGDGSYMGAKRLTEEGFPC
IGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPETEFNREDLVCEIKAGIAKGKKHAIVAITEHICDIDELARHIEQETK
RETRATVLGHIQRGGSPVAYDRILASRMGAYAIELLLQGYGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaaatcggtgtactgacgagtggcggtgattcgccgggtatgaatgctgcg
atccgtggcgttgtgcgtgccgcgctttcggaaggtctggaagtttttggtatttacgat
ggctaccttggtttgtacgaagatcgcatggaacggttggaccgctatagcgtgtccgat
atgatcaaccgcggtggtactttccttggttcagcgcgtttccctgagttcagagacgac
agcgtacgtgccaaggcgattgaaaacctgaaaaaccgcggtatcgatgcgctggtggtg
atcggcggcgacggttcctatatgggggccaagcgcctgacggaagagggtttcccttgt
atcggcctgccgggcaccattgataacgacgtggccggtaccgactacaccatcggtttc
ttcaccgcgcttgaaaccgtggttgaagcgattgaccgtctgcgcgacacctcatcttcg
catcagcgtatttccatcgttgaagtgatgggacgttattgcggcgatctgacgctggct
gcggccatcgccggtggctgtgaattcatcgtgttgcctgaaaccgaattcaaccgcgaa
gacctggtctgtgaaatcaaggccggcatcgccaaaggcaaaaaacacgcgatcgtggcg
atcaccgagcacatctgcgatatcgatgaactggcgcgccatatcgaacaagaaaccaag
cgcgaaacccgtgctaccgtgctggggcatattcagcgcggcggttcgccggtggcttac
gatcgtattctggcttcccgcatgggcgcttacgccatcgaactgctgttgcagggctac
ggtggccgttgcgtcggtatccagaacgagaagatggtgcaccacgacatcatcgatgcg
atcgaaaatatgaagcgtccgtttaagggcgactggttggatacggcgaaaaaactgtac
tga

DBGET integrated database retrieval system