KEGG   Serratia plymuthica AS9: SerAS9_4903Help
Entry
SerAS9_4903       CDS       T01503                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
srr  Serratia plymuthica AS9
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SerAS9_4903
   01230 Biosynthesis of amino acids
    SerAS9_4903
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS9_4903
   00030 Pentose phosphate pathway
    SerAS9_4903
   00051 Fructose and mannose metabolism
    SerAS9_4903
   00052 Galactose metabolism
    SerAS9_4903
  Energy metabolism
   00680 Methane metabolism
    SerAS9_4903
Enzymes [BR:srr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SerAS9_4903
Protein phosphatases and associated proteins [BR:srr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SerAS9_4903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5309025..5309987)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDSPGMNAAIRGVVRAALSEGLEVFGIYDGYLGLYEDRMERLDRYSVSD
MINRGGTFLGSARFPEFRDDSVRAKAIENLKNRGIDALVVIGGDGSYMGAKRLTEEGFPC
IGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPETEFNREDLVCEIKAGIAKGKKHAIVAITEHICDIDELARHIEQETK
RETRATVLGHIQRGGSPVAYDRILASRMGAYAIELLLQGYGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaaatcggtgtactgacgagtggcggtgattcgccgggtatgaatgctgcg
atccgtggcgttgtgcgtgccgcgctttcggaaggtctggaagtttttggtatttacgat
ggctaccttggtttgtacgaagatcgcatggaacggttggaccgctatagcgtgtccgat
atgatcaaccgcggtggtactttccttggttcagcgcgtttccctgagttcagagacgac
agcgtacgtgccaaggcgattgaaaacctgaaaaaccgcggtatcgatgcgctggtggtg
atcggcggcgacggttcctatatgggggccaagcgcctgacggaagagggtttcccttgt
atcggcctgccgggcaccattgataacgacgtggccggtaccgactacaccatcggtttc
ttcaccgcgcttgaaaccgtggttgaagcgattgaccgtctgcgcgacacctcatcttcg
catcagcgtatttccatcgttgaagtgatgggacgttattgcggcgatctgacgctggct
gcggccatcgccggtggctgtgaattcatcgtgttgcctgaaaccgaattcaaccgcgaa
gacctggtctgtgaaatcaaggccggcatcgccaaaggcaaaaaacacgcgatcgtggcg
atcaccgagcacatctgcgatatcgatgaactggcgcgccatatcgaacaagaaaccaag
cgcgaaacccgtgctaccgtgctggggcatattcagcgcggcggttcgccggtggcttac
gatcgtattctggcttcccgcatgggcgcttacgccatcgaactgctgttgcagggctac
ggtggccgttgcgtcggtatccagaacgagaagatggtgcaccacgacatcatcgatgcg
atcgaaaatatgaagcgtccgtttaagggcgactggttggatacggcgaaaaaactgtac
tga

DBGET integrated database retrieval system