KEGG   Serratia sp. AS12: SerAS12_0089Help
Entry
SerAS12_0089      CDS       T01502                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
srs  Serratia sp. AS12
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS12_0089
Enzymes [BR:srs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SerAS12_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
97180..98583
Genome map
AA seq 467 aa AA seqDB search
MSSKFPDHFLWGGAVAANQVEGAYQTDGKGLSTSDLQPQGIFGAVTPRVDGDSGIKDVAI
DFYHRYPQDIALFAEMGFKCLRTSIAWTRIFPQGDEETPNEAGLAFYDRLFDEMARYGIQ
PLITLSHYEMPYGLAKKYGGWGNRKTIGFFERYARTVFERYKHKVKHWLTFNEINMSLHA
PFTGVGLPEGSSKSEIYQAIHHQLVASAKAVKACHEIVPEGKIGNMLLGGILYPLSCRPE
DLLETQRQNRDWLFFGDVQARGGYPAYMKRYFRENGIQVEITAEDQQSLRETIDFISFSY
YMSGCVTTDETQNETARANILNMVPNPHLASSEWGWQIDPVGLRYLLNVLYDRYQKPLFI
VENGLGAKDRIEADGSINDDYRINYLNDHLVQVAEAIDDGVEVMGYTSWGPIDLVSASKA
EMSKRYGFIYVDRDDEGNGSLERRRKKSFYWYRDVIQSNGNSLKDQG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaatttccagaccattttctgtggggcggcgcggttgcggcaaatcaggtg
gaaggggcttaccagaccgacggtaaagggttgtcgacttccgatctgcaaccgcagggt
attttcggtgcggtgacgccacgggttgacggcgacagcggcatcaaggacgtggcgatc
gacttctaccatcgttatccgcaagacatcgcattgttcgcggaaatgggcttcaagtgc
ctgcgcacctctattgcctggacgcgtattttcccgcagggcgatgaggaaacccccaac
gaggccgggttggcgttttacgatcggctgttcgatgagatggccaggtacggcattcag
ccgctgattactttgtcgcactatgagatgccgtacgggctggcgaaaaagtatggcggt
tggggcaatcgcaagaccatcggcttctttgagcgctatgcgcgtactgtgtttgaacgt
tataagcacaaggtgaagcactggctgaccttcaatgagatcaatatgtcgctgcacgcg
ccctttaccggcgtcggcctgccggagggcagcagcaagagcgagatttaccaggcgatt
caccatcagctggtggccagcgccaaggcggtgaaggcctgccatgaaattgtgccggaa
ggcaaaatcggcaacatgctgttgggcggtattttgtatccgctgagctgccggccggag
gacctgctggaaacccagcggcagaaccgcgattggctgttctttggcgacgtgcaggca
cgcggcggttatccggcctatatgaagcgctatttccgtgaaaacggcattcaggtcgag
attaccgccgaggatcaacagtcgctgcgcgagactatcgattttatctcgttcagctac
tacatgagcggctgcgtcaccaccgatgagacgcaaaacgagaccgcccgcgccaacatt
ctcaacatggtgccgaacccgcatctggccagttcggaatggggctggcaaatcgacccg
gtcgggctgcgctacctgctcaacgtgctgtatgaccgttatcagaaaccgctgtttatc
gtggagaacgggctgggtgccaaggaccgcattgaagccgacggcagcatcaacgacgac
tatcgcatcaactacctcaacgatcatctggtgcaggtggcggaagcgattgacgacggt
gtggaggtgatgggttacaccagttgggggccaatcgatctggtcagcgcctctaaagcc
gagatgtccaagcgctacggctttatttatgtcgatcgcgacgatgaaggcaacggcagc
ctggagcgtcgccgcaaaaagagtttctactggtatcgcgatgtgatccagagcaacggt
aacagcctgaaagaccaaggctaa

DBGET integrated database retrieval system