KEGG   Serratia sp. AS12: SerAS12_0112Help
Entry
SerAS12_0112      CDS       T01502                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
srs  Serratia sp. AS12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SerAS12_0112
Enzymes [BR:srs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SerAS12_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
126693..127805
Genome map
AA seq 370 aa AA seqDB search
MFATLKRLTFGMLLLCAFSAAAACEWPAWQQYKQFYISEEGRVIDPSSPNRITTSEGQSY
GLFFALVANDRPTFDKLLEWTENNLAAGDLSAHLPAWLWGEDDKKRWTVLDTNTASDADL
WIAYNLLEASRLWKSRRYQTLGTLLLQRIGREEVADIPGLGLMLLPGKVGFVAEDRWRLN
PSYLPPQLLARFAALNGPWRAMQQTNQRLLLETAPHGFSPDWAVWQAGKGWQADTVKPDV
GSYDAIRVYLWAGMLADDDEHKAALIKQLLPMAQLTAQQGVPPEKADTASGKTSGDGPVG
FSAAMLPMLANQTAALDAQRQRINQHPPGDDAYFSASLTLFGQGWDQQRYRFNRQGELQP
AWGGQCVTSK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcaacgctgaaacgcctgacgttcggcatgctgctgctgtgcgcattcagcgcg
gcggcggcctgcgagtggccggcctggcaacagtacaaacagttttacatcagcgaggaa
ggacgggtgatcgaccccagcagcccgaaccgcatcaccacctcggaagggcagagctac
ggcctgtttttcgctctggtggcgaacgatcggccgacgttcgacaagctgctggaatgg
acggaaaacaacctggcggcgggcgatctcagcgcccatttacccgcctggctgtggggc
gaggacgataaaaagcgctggacggtgctggacacgaatacggcgtccgatgccgatctg
tggattgcctacaatctgctggaagccagtcgtttgtggaaaagcaggcgttatcaaact
ctgggtacgctgctattgcagcgtatcggtcgcgaagaagtggccgatattcccggactg
gggctgatgctgctgccgggcaaggtcgggttcgtggcggaagatcgctggcggctcaat
ccgagctacctgccgccgcagctgctggcgcgtttcgccgcattgaacggcccatggcga
gcgatgcagcaaaccaatcagcggctgttgctggaaaccgcgccgcacggcttttcgccg
gattgggcggtgtggcaggccggcaaaggctggcaagcggataccgtgaaaccggatgtc
ggcagttacgacgccatccgggtttatctgtgggccggcatgctggcggatgatgacgag
cataaagccgcattgatcaaacagctgctgccgatggcgcaattgaccgctcaacagggc
gttccgccggaaaaagccgacaccgccagcggtaaaaccagcggcgatggcccggtgggc
ttctccgccgccatgctgccgatgttggccaaccaaacggctgcgctggacgcccagcgt
caacgcatcaatcaacaccctccgggcgacgatgcctatttcagcgcctctttgacgctg
ttcggccagggatgggatcaacaacgttatcgttttaatcggcagggtgaacttcaaccc
gcctggggcggccaatgcgtaacttcaaaataa

DBGET integrated database retrieval system