KEGG   Serratia sp. AS12: SerAS12_0259Help
Entry
SerAS12_0259      CDS       T01502                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
srs  Serratia sp. AS12
Pathway
srs00010  Glycolysis / Gluconeogenesis
srs00620  Pyruvate metabolism
srs00640  Propanoate metabolism
srs00680  Methane metabolism
srs01100  Metabolic pathways
srs01110  Biosynthesis of secondary metabolites
srs01120  Microbial metabolism in diverse environments
srs01130  Biosynthesis of antibiotics
srs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS12_0259
   00620 Pyruvate metabolism
    SerAS12_0259
   00640 Propanoate metabolism
    SerAS12_0259
  Energy metabolism
   00680 Methane metabolism
    SerAS12_0259
Enzymes [BR:srs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SerAS12_0259
Lipid biosynthesis proteins [BR:srs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SerAS12_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEF48373
JGI: SerAS12_0259
Position
complement(303387..305345)
Genome map
AA seq 652 aa AA seqDB search
MSQVHKHAIPSAIAEHALINPEQYQQYYQQSVQDPEAFWGEQGKILDWIKPYSRVKNTSF
DPGHISIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPTQSKQVTYKQLHHDVCQF
ANVLKKLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
KLVITADEGLRAGRAVPLKKNVDDALKNPGVKSITNVVVFQRTGKPGYWQEGRDLWWHEL
TNGVSADCPPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAAMTFKYVFDYHDGDV
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVNRLSQVIDKHQVNILYTAPTA
IRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNGKCPIVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNIGTPQEGACEGNLVITDSWPGQARTLFGD
HDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYITLNHGEEPSPELYTEVRNWVRKEIGPIATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPAVVDKLLEEKQSMKVPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagtgcataaacacgctattccttctgcaattgcagaacacgccctgattaac
ccagaacaataccaacaatattatcaacagtctgtccaagacccagaggctttctggggc
gagcaaggaaagatcctggactggatcaaaccttatagccgggtaaaaaacacgtcgttc
gacccgggccatatcagtatccgctggtttgaagacggcactctgaacctggcggccaac
tgtctcgatcgccatctggccgaacgcggtgaccagaccgccattatctgggaaggtgac
gaccccacccagtcgaaacaggtgacctacaaacagctgcatcacgatgtctgccagttc
gccaacgtactgaaaaagttgggcgtcaaaaaaggcgacgtcgtggctatctatatgccc
atggtgccggaagccgcggtcgccatgctggcctgtgcacgtatcggtgcggtgcactcg
gtaatctttggcggtttctcgccagaggcggtcgccggccgcattatcgactccaattcc
aagctggttatcaccgctgacgaaggcctgcgcgccgggcgcgccgtaccgctgaaaaag
aacgtcgacgacgcgctgaaaaatcctggcgtgaaaagcatcaccaacgtggtcgttttc
caacgcaccggcaagccgggttattggcaggaaggccgtgatttatggtggcatgaactg
accaacggcgtttccgccgactgtccaccggaagagatgaatgcggaagacccgttgttt
atcctttatacctccggatcgaccggcaaacccaagggcgtgctgcacaccaccggtggc
tatctggtgtatgccgccatgaccttcaagtacgtcttcgactaccacgacggtgacgtg
tactggtgtacggccgacgtcggctgggttacaggccacagctatctgctctacggcccg
ctggcctgcggcgccatcaccctgatgttcgaaggcgtgccgaactatcctggcgtcaac
cgcctgtcacaggtgattgataagcatcaggtcaatatcttgtataccgcccccaccgcc
attcgtgcgctgatggccgaaggcgataaagcgatagaaggcaccaaacgcgattcactg
cgcatcatgggttcggtcggggagccgatcaacccggaagcctgggagtggtattacaac
aaaatcggtaacggcaaatgcccgatcgtcgacacttggtggcagaccgaaaccggcggc
tttatgatcaccccgctgccgggtgcaaccgagttgaaagccggctctgccacgcgcccg
ttcttcggcgtgcagcctgccttggtcgataacatcggcacaccgcaggaaggtgcctgc
gaaggcaatttggtgatcaccgattcctggccaggccaggcacgtacgctgtttggcgat
cacgatcgctttgagcagacttacttctcaacctttaaggggatgtatttcagcggtgac
ggcgcacgccgtgatgaagatggatattactggatcacagggcgcgtcgatgacgtgctg
aacgtttccgggcaccgtctgggtaccgcagaaatcgagtctgcgctggtctcgcatccg
aaaatcgccgaagcggcggtagtcggtattccgcataacattaaaggtcaggcaatttat
gcctatatcacgctgaatcatggcgaagaaccttctcccgaactctataccgaagttcgt
aactgggtacgcaaggaaatagggccgatcgccacgccggacgtgctgcactggacagac
tctctgcctaaaacgcgttcaggtaagatcatgcgtcgcatcctgcgcaaaatcgctgcg
ggtgacaccagtaatctcggggacacctcaaccttggcggacccggccgtagtagacaag
ctattggaagaaaaacaatccatgaaagtaccgtcgtaa

DBGET integrated database retrieval system