KEGG   Serratia sp. AS12: SerAS12_0479Help
Entry
SerAS12_0479      CDS       T01502                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
srs  Serratia sp. AS12
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SerAS12_0479
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SerAS12_0479
Enzymes [BR:srs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SerAS12_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
526820..529213
Genome map
AA seq 797 aa AA seqDB search
MHRPLRYTLLASSLLLSLGALAQPAGSLPLMPWPQQVELTQPAGRLVLDHRLTFKVQGDD
LAEAELRWRQRIELQTGWTLAPQTAKAEGAAIQVNIKDKVAAQPLLGSDESYKLTVTPQG
ATLTANTRFGALHGMETLLQLVQTDGQNTFLPLVTIADVPRFPWRGVLLDSARHFLPLPD
ILRQLDGMAAAKLNVFHWHLTDDQGWRFASELYPKLQQLASDGQFYTREQMQQVVAYATA
RGIRVVPEIDLPGHASSIAVAYPELMSAPGPYPMEREWGVHKPTLDPTRDEVYRFVDAII
GELAAIFPDPYLHIGGDEVDASQWKASASIQAFMQKNQLADTHALQAYFNQKLEKILEQH
QRRMVGWDEIYHPSLPRTIVIQSWQGPDSLGASAQDGYQGILSTGFYLDQPQSTAYHYRN
EILPQPLGVDTEVQPAEQAQSWQFSMPRLKGSAVEGSFTLIEGKQGWRGFIDFNGKSRRA
LHDIVWRSPQQVTFRLDSWMGETRPVFRLQQDQLSGYTLIGNVRYPTSGSRLAAIPAGKM
PVVPGAKQRANILGGEAALWAENVRAPILDLKLWPRAFAVAERLWSAQDVTDENNMYQRL
AAVDAWSVVSVGLQQHAETAREFTRLANSVEILPLQILAEAVEPGQYYTRQHLKFKAGNY
HQFEPLNRFADALPPESNAVRDMGRQVEALLKDKNDRAAAQAIRERLQRWQLNTAAVKTT
VAGNRVLQDLAPVAQDVGALSTLGLMLLERYQQGKPLSKTEAGQIQQQLDAAAQVRDEVV
IAAVYPLEALLRACAIE
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgcatagaccgctccgttatacgctactggcttcatcgttattgctttccctcggcgcg
ttggcccaaccggctggctcgctgccgctgatgccctggccacagcaggtcgaactgacg
cagccggcgggcaggctggtgctggatcaccgcctcacgtttaaggtgcagggcgacgat
ctggcagaggcggagctgcgctggcggcaacgcatcgaactgcagaccggttggacgctg
gcaccgcaaaccgcaaaagccgagggcgcggcgattcaggtgaatatcaaagataaagtg
gccgctcagccactgctcggcagcgatgaaagctacaagctgacggtgacgccgcagggc
gccacactgaccgccaatacccgcttcggcgcgctgcacggcatggaaaccctgttgcaa
ctggtgcagaccgacggccaaaacaccttcttgccgctggtgacgattgccgatgtgccg
cgtttcccgtggcgcggcgtgctgctggattcggcgcgccatttcttgccgctgcctgat
atcctgcgccagctcgacggcatggcggcggccaaactcaatgtcttccattggcatctg
accgacgatcaaggctggcgctttgcttctgagctctaccccaaactgcaacagctggcc
agcgacggccagttctatacccgcgaacagatgcaacaggtggtggcctacgccacggcg
cgcggcatccgggtggtgccggaaatcgatctgccgggccatgcctccagcatcgccgtg
gcttacccggaattaatgagcgcgccggggccgtatccgatggagcgcgagtggggcgtg
cacaagccgacgctcgatccgacccgcgacgaggtttatcggttcgttgacgcgatcatc
ggcgaattggcggcgattttccccgatccctacctgcatatcggcggtgatgaagtcgac
gccagccagtggaaggcatcggcctcgattcaggcgtttatgcaaaaaaatcagctggcg
gatacccatgcgctgcaagcctacttcaaccagaagctggagaaaatcctcgaacagcac
cagcggcgcatggttggctgggatgagatttatcacccgtcgctgccgcgcaccattgtc
atccagtcctggcaggggccggattcgcttggcgccagtgcgcaggacggctaccagggc
attctgtccaccggtttctacctcgaccaaccgcagagcaccgcctatcactatcgcaac
gaaattttaccccagccgctgggggtagataccgaggtacagcccgctgagcaggcacag
agctggcagttcagcatgccgcgcctgaagggcagcgcagtagaaggcagttttactttg
atcgaaggcaagcagggctggcgtggttttatcgacttcaacggcaaatcccgccgtgcg
ttgcacgatatcgtctggcgttctccgcagcaggtaaccttccgcctcgacagctggatg
ggcgagacgcgcccggtattcaggctgcaacaggaccaactgagcggctatacgctgatc
ggcaacgtgcgctacccgaccagcggcagcaggctggcggcgatcccggcgggcaaaatg
ccggtggtgccgggggcgaagcagcgggccaatattctcggcggcgaggcggcgctgtgg
gcggaaaacgtccgtgcgccgatcctcgatctcaagctgtggccgcgggcctttgcggtg
gcggagcggctgtggtcggcgcaggatgtgaccgatgaaaacaacatgtaccaacggttg
gcggcggtggatgcctggtcggtggtgtcggtgggcttgcagcagcatgccgaaactgcc
cgcgaattcacccggctggcgaacagcgtggagattttgccgctgcaaattcttgccgag
gcggtggagcctgggcagtactacactcgccagcacctgaaattcaaggccggcaattat
catcagttcgaacctttgaaccgttttgccgacgcgctgccgccggaaagcaacgcggtg
cgcgacatggggcgacaggttgaggcgttgctgaaggacaaaaacgatcgcgcagcggcg
caggcgatccgcgagcgtttgcaacgctggcaattgaacaccgcagcggtgaaaacgact
gtcgccggtaaccgggtattgcaggatttggctccggtggcgcaggacgtcggtgcgctg
tctacgctggggttgatgctgttggagcgctatcagcagggtaagccgttgagtaaaacc
gaagccgggcagatacaacagcaattggatgccgcagcgcaggtgcgcgacgaagtggtg
attgcggcggtctacccgctggaggcactgctgcgcgcctgcgcgatcgaatag

DBGET integrated database retrieval system