KEGG   Serratia sp. AS12: SerAS12_0590Help
Entry
SerAS12_0590      CDS       T01502                                 

Definition
DNA-directed DNA polymerase (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
srs  Serratia sp. AS12
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SerAS12_0590
   00240 Pyrimidine metabolism
    SerAS12_0590
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SerAS12_0590
   03430 Mismatch repair
    SerAS12_0590
   03440 Homologous recombination
    SerAS12_0590
Enzymes [BR:srs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SerAS12_0590
DNA replication proteins [BR:srs03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SerAS12_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
656937..657374
Genome map
AA seq 145 aa AA seqDB search
MASKRDWLLQQLGITQWTLRRPGVLQGEVAVSLPPDVRLLVVAQPLPEHNDPLFCDVLRS
LGLTPAQTYGLTPDQVAMLPEDTECNSWRLGVAEPLAVAGAQLHSPALAELSLDASAKRA
LWQQICHHEQYFYPDGGRSGHGIQD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaaacgcgactggctgttacaacaactgggtattacgcagtggacattgcgc
cgcccgggcgtgttgcagggcgaagtagcggtcagcctgccgcccgatgtgcgtttgctg
gtggtggcgcagccactgcctgagcataacgatccgctgttttgcgacgtgttgcgcagc
ctggggctgaccccggcgcaaacctatggcctgacgccggaccaggtagcgatgctgcct
gaggataccgaatgcaacagttggcggctgggcgtcgcggagccgctcgcggtggccggc
gcacaactacacagcccggcactggccgagctttccctcgacgcgagtgccaagcgcgca
ctctggcagcagatttgtcatcatgaacagtatttctaccctgacggcggccgatctggc
cacggcattcaagattga

DBGET integrated database retrieval system