KEGG   Serratia sp. AS12: SerAS12_0602Help
Entry
SerAS12_0602      CDS       T01502                                 

Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
srs  Serratia sp. AS12
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:srs00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
667517..668839
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQPLNEAEIRFFINGIRDNVVSEGQIAALAMTIYFHDMTMPERVALT
MAMRDSGTVLDWKSLSLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFNIFPDDSAFRKIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYALSADLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAKDDADARAKL
QAVLDNGKAAEVFGRMVAAQQGPTDFVERYDSYLPAATLSKPVYAEKQGIISAMDTRALG
MAVVSLGGGRRRATDNIDYSVGLTGMARLGDKVDTQQPLAVIHANDEESWQQAAEAVRSA
MVLSDKAPEATPVVYKRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctggcacaagaaattattcgtaaaaaacgtgacggtcagccgttgaacgaggcg
gaaatccgctttttcatcaatgggatccgtgacaatgtggtttcagaaggtcagatcgcc
gcgctggcgatgaccatttatttccacgatatgaccatgccggagcgcgtggcgctcacc
atggcgatgcgtgattccggcaccgtgctggattggaaaagcctgtcgttgaacggaccc
ttggtcgacaagcactccaccggcggcgtgggcgatgtcacttcgctgatgctaggccct
atggtggccgcctgcggcggctacgtgccgatgatttccggccgcggtctgggccatacc
ggcggcacgctggacaagctggaagccataccgggttttaacattttcccggacgacagc
gccttccgcaaaattattcaggacgttggcgtggcgattatcggccagaccagctcgctg
gcaccggcggacaagcgtttctacgccacccgcgacatcaccgccaccgtggattctatc
ccgctgattaccgcctctattctggcgaagaagctggcggaagggctggatgcgctggtg
atggacgttaaagtcggctccggcgcctttatgccgacctatgcgctgtcggccgatctg
gcgcaggcgatcgttggcgtggccaatggcgcagggtgcaaaactaccgcgctgctgacc
gacatgaatcaggtactggcctccagcgccggcaatgcggtggaagtacgagaagcggtg
cgtttcctgaccggcgaataccgcaacccgcgcctgctggaagtgacgatggcgctgtgc
gtggaaatgctgctttccggcggcctggcgaaagatgacgccgacgcgcgcgccaagctg
caggcggtgctggacaacggcaaagcggcagaagtgtttggccgcatggtggcggcacag
cagggcccgaccgattttgttgagcgctacgacagctatctgccggcagcgaccctgagc
aaaccggtttacgccgaaaaacagggcattatcagcgcgatggatacccgtgcgctgggc
atggcggtggtatcgctgggcggcggtcgtcgccgcgcgaccgacaatatcgattacagc
gtcggcctgaccggcatggcgcgcctgggcgataaagtggatacccagcaaccgctggcg
gtgatccacgccaacgacgaagagagttggcagcaggcggccgaagcggtacgcagcgct
atggtgctgagcgataaagcgccggaagcgacgccagtggtctataagcgcatcacagaa
tag

DBGET integrated database retrieval system