KEGG   Serratia sp. AS12: SerAS12_0654Help
Entry
SerAS12_0654      CDS       T01502                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
srs  Serratia sp. AS12
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SerAS12_0654
   00670 One carbon pool by folate
    SerAS12_0654
Enzymes [BR:srs01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SerAS12_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
729430..729912
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRHN
IVLSSRPGSEAGVTWATSLDDALAAAGDVEEVMVMGGGHIYTQFLARADRMYLTHIDAEV
GGDTHFPDYEPDEWETSFSEFHDADELNSHSYCFEILERR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgatcgctgccttggcggcggatcgcgttattggtatggaaaacgcc
atgccgtggcatttaccggcagacttagcgtggtttaaacgtaacacgctgaataaaccg
gtcattatgggccgtaaaacgttcgagtccattggtcgcccgctgccgggccgccataac
atcgttttaagcagccgtcccggcagtgaagccggggtgacctgggctacgtctttggac
gacgcgctggctgcggccggtgatgtggaagaagtcatggtcatgggcggtgggcatatc
tacacccagttcctggcgcgtgctgaccgcatgtatctgacgcatatcgacgccgaagtc
ggtggcgacacccatttcccggactacgagccggacgaatgggaaacctcgttcagcgaa
ttccatgatgctgacgaactgaactcccacagctactgctttgagattttagaacgccgt
tga

DBGET integrated database retrieval system