KEGG   Serratia sp. AS12: SerAS12_0892Help
Entry
SerAS12_0892      CDS       T01502                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
srs  Serratia sp. AS12
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:srs01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:srs00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
990261..991364
Genome map
AA seq 367 aa AA seqDB search
MNGSQTLVVKLGTSVLTGGSLRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADLEDRERFLNARDT
MTALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLYTADPR
NNPQAELIREVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDVIIAAGSKPG
VVGDVIEGKPVGTRFHALETPLENRKRWIFGAPPAGEITVDDGAVEAIMARGSSLLPKGV
REVKGDFSRGEVIRIRNLAGRDLAHGVSRYNSDAMRMIAGHHSQEISEILGYEYGPVVVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagccagacattggttgtgaaattgggcaccagcgtgttgaccggcggatcg
ctgcgtcttaaccgtgcccatattgtcgaactggtacgccagtgcgcacaacagcatgca
gcgggtcaccgcatcgttattgtcacctctggcgcgattgccgccgggcgcgaacatttg
ggctaccccgaactccccgccaccatcgcctccaagcagctgcttgcggcggtcggccag
agccggttgatccaactgtgggaacagctgttctccatttatggcatccacgtcgggcag
atgctgctgacgcgcgccgatctggaagaccgcgaacgcttcctcaacgcgcgtgacacc
atgaccgcgctgctggacaaccgtatcgtgccggtaatcaatgagaatgacgcggtagcg
accgcagaaatcaaggtgggcgacaacgacaacctgtcggcgctggcggcgatcctggcc
ggggccgacaaactgctgctgctgaccgatcaacaaggcctgtataccgccgacccgcgc
aacaacccgcaggcggaactgatccgcgaagtgcatggcattgacgacgcgctgcgcgcc
atcgccggcgacagcgtttccgggttgggcacaggcggcatgggcaccaaattgcaggcg
gccgacgtggcctgccgcgccggtatcgacgtgatcatcgccgcaggcagcaagccgggc
gtggtgggcgacgtgattgaaggcaaaccggtgggcacccgtttccacgcgctggaaacc
ccgctggaaaaccgcaaacgctggatcttcggcgcaccgccggccggtgaaatcaccgtg
gacgacggcgcggtcgaggccattatggcgcgcggcagctcgttgctgccgaagggcgtt
cgcgaagtgaagggcgatttctctcgtggcgaagtgatccgcatccgcaacctggcgggg
cgcgatttggcgcacggcgtcagccgctataacagcgacgcgatgcgcatgattgccggc
caccactcgcaggaaatcagcgaaattctcggttacgaatacggcccggtggtagtgcac
cgcgacgacatgattgtgagctaa

DBGET integrated database retrieval system