KEGG   Serratia sp. AS12: SerAS12_1236Help
Entry
SerAS12_1236      CDS       T01502                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
srs  Serratia sp. AS12
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SerAS12_1236
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SerAS12_1236
   00650 Butanoate metabolism
    SerAS12_1236
  Energy metabolism
   00190 Oxidative phosphorylation
    SerAS12_1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1352015..1352362
Genome map
AA seq 115 aa AA seqDB search
MVNNVSALGRNGVHDWLLLRASAIVITLYVLYILGFFVTAPDLTYEIWRGFFATSITKVF
TLLTLLSILVHAWVGLWQVLTDYVKPLAVRLVLQLAIVVVLLVYLLYGTIVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtttctgcattagggcgcaacggcgtacacgactggttgttactgcgt
gcttccgctatcgtcatcaccctgtacgtgctgtatatcctgggcttcttcgttacggct
ccggatctcacctatgaaatctggcgcggcttcttcgccacctctattacgaaagtgttc
acgctgctgacgctgctgtcgattctggttcacgcctgggtcggtttgtggcaggtgctg
acggactacgtcaaaccgctggcagtgcgtctggtgttgcaactggcgatcgttgtcgtg
ttgctggtctatttactgtacggaacaatcgtagtgtggggtgtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system