KEGG   Serratia sp. AS12: SerAS12_1240Help
Entry
SerAS12_1240      CDS       T01502                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
srs  Serratia sp. AS12
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SerAS12_1240
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SerAS12_1240
  Amino acid metabolism
   00310 Lysine degradation
    SerAS12_1240
Enzymes [BR:srs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SerAS12_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1358085..1359305
Genome map
AA seq 406 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASEAGILDAI
VEEEGATVLSRQILGRIRPGDSSGKPTEEKSQAKEATPAQRATASLEEESNDALSPAIRR
LIAEHDLDAAAIKGSGVGGRITREDVEAHLANGKKADKPAAAAVEAAPQPALSNRSEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGEAFEKRHGVRLGFMSFYI
KAVVEALKRFPEVNASIDGTDVVYHNYFDISIAVSTPRGLVTPVLRDVDSMSMADIEKKI
KELAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVN
GQVVIQPMMYLALSYDHRLIDGKESVGYLVTVKEMLEDPARLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcctgaccttcctgaatcggttgccgatgcgaccgta
gccacctggcacaagaaaccaggcgacagcgtccagcgtgacgaagttctggttgaaatc
gaaactgacaaagttgtgttggaagtgccggccagcgaagcaggtattcttgatgcgatc
gtggaagaagagggcgcaaccgtgctttctcgccagatcctcggccgtattcgcccgggc
gatagctctggcaagccgaccgaagagaaaagccaggctaaagaagccactccggcacag
cgcgcaaccgccagcctggaagaagagagcaacgatgcactcagcccggcgatccgccgt
ctgattgccgaacacgatctcgatgctgcagccatcaaaggcagcggcgtgggtggccgc
atcactcgcgaagacgtggaagcgcatctggctaacggcaagaaagccgacaagccggcc
gcagctgcagttgaagccgcaccgcagcctgccctgagcaaccgcagcgaaaaacgcgtg
ccgatgacccgtctgcgcaagcgcgtggcagagcgtttgttggaagcgaagaacagcact
gcgatgctgactaccttcaatgaaatcaacatgcagccgatcatggacctgcgcaagcag
tacggtgaagctttcgaaaaacgccacggtgtacgtctgggcttcatgtccttctacatc
aaggcggtggttgaagcgctgaaacgcttcccggaagtgaacgcttccattgatggtact
gatgtggtctaccacaactatttcgatatcagcattgcggtatctaccccacgcggcctg
gtgaccccggtactgcgcgatgtagacagcatgagcatggcggacatcgagaagaaaatc
aaagagctggcggtcaaaggccgtgacggcaaattgaccgtggaagaactgaccggcggt
aacttcaccattaccaacggcggcgtattcggttcactgatgtctaccccgatcatcaac
ccaccgcagagcgcgatcctgggcatgcacgccattaaagatcgcccaatggcggtgaat
ggccaggttgtgatccagccaatgatgtatctggcactttcttacgatcaccgcttgatc
gacggcaaagagtccgttggttacctggtgacggtgaaagagatgctggaagatccggct
cgtctgctgctggacgtataa

DBGET integrated database retrieval system