KEGG   Serratia sp. AS12: SerAS12_1241Help
Entry
SerAS12_1241      CDS       T01502                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
srs  Serratia sp. AS12
Pathway
srs00020  Citrate cycle (TCA cycle)
srs00640  Propanoate metabolism
srs00660  C5-Branched dibasic acid metabolism
srs01100  Metabolic pathways
srs01110  Biosynthesis of secondary metabolites
srs01120  Microbial metabolism in diverse environments
srs01130  Biosynthesis of antibiotics
srs01200  Carbon metabolism
Module
srs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
srs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SerAS12_1241
   00640 Propanoate metabolism
    SerAS12_1241
   00660 C5-Branched dibasic acid metabolism
    SerAS12_1241
Enzymes [BR:srs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SerAS12_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEF49331
JGI: SerAS12_1241
Position
1359423..1360589
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAEAWLGKRLVTYQTDALGQPVHQILVEAATDIDKELYLGAVVDRASRR
VVFMASTEGGVEIEKVAEETPELIHKMTIDPLAGPQPYQGRELAFKLGLTGKQVGQFAKI
FMGLATLFLERDLAMVEINPLVVTKQGDLICLDGKLGADGNALFRQSELREMRDPSQEDE
RESRAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacagctgtttgctcggtatggcatgccggcacca
accggttacgcctgtaccacaccgcgtgaagcagaagaagccgcatccaaaatcggctcc
ggcccgtgggtggtaaaatgtcaggttcatgctggcggtcgcggtaaagctggcggcgtt
aaagtggttaacagcaaagaagacatccgtgctttcgctgaagcctggctgggcaagcgt
ctggtgacctaccagactgacgcgctgggccaaccggtccaccagatcctggtagaagcg
gcgaccgacatcgataaagaactgtatctgggtgcggtagttgaccgtgcaagccgtcgc
gtggtgtttatggcatccaccgaaggtggcgttgagattgaaaaagttgcggaagaaacc
ccggaactgatccacaaaatgaccatcgacccactggcaggcccacagccttaccagggc
cgtgagttggccttcaaactgggtctgaccggcaagcaagtcggtcagttcgccaagatc
ttcatgggtttggcgaccttgttcctggagcgcgacctggcgatggttgagatcaacccg
ctggtagtcaccaagcagggcgatctgatctgcctggacggcaaactgggtgccgacggc
aacgcactgttccgccagtctgaactgcgtgaaatgcgtgacccttctcaggaagatgag
cgtgaatcccgcgctgcacagtgggagctgaactacgttgctctcgacggcaacatcggt
tgcatggttaacggcgcaggtctggcgatgggtaccatggacatcgttaaactgcacggc
ggcgaaccggccaacttcctcgacgtaggcggcggcgcgaccaaagagcgcgtgactgaa
gcgttcaaaatcatcctgtctgacgacaaggtgaaagcggttctggttaacattttcggt
ggtatcgtacgctgcgatctgatcgccgacggcatcattggcgcagtcgccgaagtgggc
gttaacgtccctgtggtcgtgcgtctggaagggaacaatgccgaactgggcgccaagaaa
ctggcggacagcggtctgaatatcattgctgcgaccagcctgactgatgcggctcagcaa
gttgttgcggcagtggagggtaaataa

DBGET integrated database retrieval system