KEGG   Serratia sp. AS12: SerAS12_1499Help
Entry
SerAS12_1499      CDS       T01502                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
srs  Serratia sp. AS12
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SerAS12_1499
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SerAS12_1499
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SerAS12_1499
Enzymes [BR:srs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SerAS12_1499
Exosome [BR:srs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SerAS12_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1613047..1614474)
Genome map
AA seq 475 aa AA seqDB search
MLQPVSLIAGAVLSALLCSTAFADETPANTAGLSERAARGNIVEPGGARRLSGDQTAALK
ASLSDKTVKNVILLIGDGMGDSEITSARNYAEGAGGYFKGIDALPLTGQYTHYSLDKKTH
KPDYVTDSAASATAWSTGVKTYNGALGVDVNGKDQPTLLEIAKAAGKATGNVSTAELQDA
TPAAQVSHVTSRKCYGPEETSEKCATNALENGGRGSITEQLLKTRADVSLGGGAKSFNQL
AKSGEWQGKSLKDQATALGYQWVENLDGLNAISVANQQKPLLGLFAAGNMPVRWQGPKAS
HHGNIDQPAVTCENNPARTADIPTLAAMTEKAIDLLKNQQNGFFLQVEGASIDKQDHEAN
PCGQFGETVDLDEAVQKALAFARADGNTLVIVTADHAHSSQIIAVDAKAPGLTQTLTTKD
GAPMTISYGNSEEGSQGHTGTQLRVAAYGPRAANVVGLTDQTDLFYTMRDAMAIK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagcccgtttctttgatcgctggcgccgtactatccgccctgctttgttccacc
gccttcgccgatgaaacaccggccaataccgcgggtctttccgagcgcgcggcgcgcggt
aacatcgtggagccgggcggcgcacgccgtctgagcggcgatcaaaccgccgcgctgaaa
gcctcgctgtctgacaaaacggtcaaaaacgtgattttgctgattggcgacggcatgggc
gattctgaaatcacctcggcgcgcaactacgcagaaggcgcgggcggctattttaaaggc
attgatgccctgccgctgaccggtcaatacacccattactcgctggataagaaaacccac
aagccagattacgtgacggattccgccgcctcggcgaccgcatggtcaaccggcgtaaaa
acctataacggcgcgctgggggttgacgtcaacggcaaggatcagccgacgctgctggaa
atcgccaaggcggcaggtaaagccaccggcaacgtctccaccgccgagctgcaggacgcc
acaccggcagcgcaggtctcgcatgtcacctctcgcaaatgttacggcccggaagaaacc
agcgaaaaatgcgccaccaacgcgctggagaatggcggccgtggctcgatcaccgagcaa
ttgctcaaaacccgcgccgacgtctcgctgggcggtggggcgaaatcctttaatcagctg
gcgaaaagcggcgaatggcagggaaagtcattgaaagaccaggcaactgcgctgggttat
cagtgggtggaaaaccttgacggcctgaatgccatcagcgtagccaatcagcaaaaaccg
ctgctggggttgtttgccgccggcaatatgccggtgcgctggcagggcccaaaagcctcg
catcacggtaatatcgaccaaccggcggtcacctgcgagaacaacccggcacgtactgcc
gacatcccaacgctggcggcaatgaccgaaaaagcgatagatctgctgaaaaatcagcaa
aacggtttcttcctgcaggtggaaggcgcatcgatcgacaagcaggaccatgaagccaac
ccttgcggccagttcggcgagacggtcgatctggatgaagcggtacagaaagcgctggcc
ttcgcccgcgccgacggcaacacgctggtgattgtcaccgccgaccacgcccattccagc
cagattattgccgtcgatgccaaagcgccaggcctgacgcaaacgctgaccaccaaagat
ggtgcgccaatgaccatcagctacggtaactcggaggaaggctctcagggacacaccggc
acccagttgcgcgttgccgcctacggcccgcgtgccgctaacgtcgtgggactgaccgat
cagaccgacctgttctacaccatgcgtgacgccatggcgattaagtaa

DBGET integrated database retrieval system