KEGG   Serratia sp. AS12: SerAS12_1551Help
Entry
SerAS12_1551      CDS       T01502                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
srs  Serratia sp. AS12
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:srs00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:srs00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:srs00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:srs00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1670353..1671252
Genome map
AA seq 299 aa AA seqDB search
MQKRLKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVNECVAAGIKDIVLVTHSS
KNAIENHFDTSFELEAVLESRVKRQLLEEVQTICPADVTVMQVRQGQAKGLGHAVLCAKP
MIGDEPFIVLLPDVLLDDSTADLRKENLAKMIQRFADTGFSQIMVEPVPEQDVSKYGVVD
CGGATLAAGASTPMTAVVEKPTREEAPSNLAVVGRYVLSADIWPLLEKTLPGAGDEIQLT
DAIAALMEQETVEAFHMSGKSHDCGDKLGYMKAFVQYGLRHASEGEDFTQWLKQTLNSK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagagactgaaggccgtgattcccgtagctggcttgggaacccgtatgttgccg
gcaacaaaagccatccctaaagaaatgttgcctgtggtcgataagccgctaatccaatac
atcgttaacgaatgtgttgctgcggggataaaagatatcgttctggtgactcactcctcc
aaaaatgcgattgagaaccacttcgatacctcctttgagctcgaagccgttttggagtcg
cgtgttaagcgccagctgctggaagaagtgcaaaccatctgtccagcagacgtgacggtg
atgcaagtccgtcagggccaagcgaaaggtctgggacacgcggtactctgcgccaaacca
atgatcggcgatgagccttttatcgtgttattgccggatgtattgctggatgactctacc
gccgatctgcgtaaagaaaacctggccaaaatgattcagcgttttgcggatactggcttc
agtcaaatcatggtggaaccagtaccggaacaagacgtgtcgaaatacggcgttgtagat
tgcggcggtgctactctggcagcaggtgcaagcacaccaatgactgctgtggtcgaaaag
ccgacaagagaagaagccccttccaatctggcagtggtagggcgttatgtgttgtctgcg
gatatctggcctttgctggaaaaaaccttgccgggggccggtgatgaaattcagcttact
gatgcgattgccgccctgatggagcaggaaaccgtagaagctttccatatgagcggcaaa
tcgcacgactgcggcgataagttgggctatatgaaagcgttcgtacaatatggcctgcgt
catgcttcggaaggtgaagattttacccaatggctgaagcagacattgaacagtaaataa

DBGET integrated database retrieval system