KEGG   Serratia sp. AS12: SerAS12_1590Help
Entry
SerAS12_1590      CDS       T01502                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
srs  Serratia sp. AS12
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SerAS12_1590
Enzymes [BR:srs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     SerAS12_1590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1719957..1720889
Genome map
AA seq 310 aa AA seqDB search
MLNQPQSGNEMPRFAGIPTMMRLPVADDAQGLAAAFVGVPLDIGTSNRSGTRYGPRQIRQ
ESVMLRPYNMGTGAAPFERLQVADLGDIAINPYSLEDSVRRIELAYNGILSHGCVPLTLG
GDHTLTLPILRAVACRHGPVGLIHVDAHSDTNEEMFGEKLAHGTTFRRAYEEGLLEPQRV
VQIGLRGSGYAADDFDWSRRQGFRVVPAEECWYRSLVPLMAEVRQQMGGAPVYLSFDIDG
LDPAFAPGTGTPEVGGLSVWQGLEIVRGCRGLNLIGADVVEVSPAYDRSGNTALLAANLL
FEMLCVLPDR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatcaaccccagagcggtaatgaaatgccgcgttttgccggcatccccaccatg
atgcgcctgcccgtagccgatgatgcccaggggctggctgcggcctttgtcggcgttcct
ctcgatataggcacttcgaatcgcagtggaacgcgctacgggccacggcaaattcgccag
gagtcggtgatgctccgtccctacaacatgggcaccggcgccgcgccttttgagcggctg
caagtcgccgatctgggtgatatcgccattaatccctacagcctggaggacagcgttcgt
cgcattgagctggcctataacggcattttgtcccacggctgcgttccgctgacgctgggg
ggcgatcacacgctgacgctgccgatcctgcgcgccgtagcctgtcgccatggcccggtt
gggttaatccatgttgacgcccattctgacaccaacgaagagatgtttggcgaaaagctg
gcccacggcaccacttttcgccgcgcctatgaagaagggctgctggagccgcaacgggtg
gtgcagattggcctgcgcggcagcggttatgcggcggacgattttgattggtcgcggcgg
caggggttccgtgtggtgccagcggaggagtgctggtatcgctcgctggtgccgttgatg
gcggaggtgcgtcagcaaatgggcggtgctccggtttacctcagctttgatatcgacggg
ctggatccggcgtttgcgccaggcaccgggacgccggaggtgggggggctgtcggtctgg
caggggctggagattgtcaggggatgtcgggggctaaatctgatcggcgcggacgtggtg
gaggtctcgccggcttatgaccgttccggcaacacagctctgctggcggcaaacctgctg
tttgaaatgctgtgcgtcctgcctgacagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system