KEGG   Serratia sp. AS12: SerAS12_2094Help
Entry
SerAS12_2094      CDS       T01502                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
srs  Serratia sp. AS12
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:srs00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:srs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2248624..2249175
Genome map
AA seq 183 aa AA seqDB search
MSQPIYDIPVNTIENQSTTLGEYEGKALLVVNVASECGLTKQYEGLEALYETYRAEGFEV
LGFPSNEFLGQEPGSNEEILAFCRGTFGVQFPMFAKIEVNSDDRHPLYQALIAAKPQAVA
PEGSEFLARMSSKGRAPKQTGDILWNFEKFLIGRDGQVIERFSPDTTPEDPALVAAVKQA
LAG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacctatctatgacattccggtaaacactatcgaaaatcaatccaccaccttg
ggcgaatatgaaggcaaagcgctgttggtggttaacgtggcgtcggaatgtggcttgacc
aagcaatatgaagggctggaagcgttatacgaaacctatcgcgcagagggttttgaggtg
ttgggcttcccgtccaatgagttcctggggcaagaacccggcagcaatgaagagatcctg
gcattttgccgcgggaccttcggtgtacagttcccgatgttcgccaaaattgaagtgaac
agcgacgaccgccatccattgtatcaggcgttgattgccgcaaaaccgcaggcggtcgcg
ccagagggcagcgagttcctggcgcgtatgagtagcaaaggccgtgcgccgaagcaaact
ggcgatatcttgtggaactttgaaaagttcctgattgggcgcgatggccaagtgatcgag
cgtttctcgccggacacgacgccggaagatccggcgctggtggccgctgtcaaacaggcg
ctggccggataa

DBGET integrated database retrieval system