KEGG   Serratia sp. AS12: SerAS12_2351Help
Entry
SerAS12_2351      CDS       T01502                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
srs  Serratia sp. AS12
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SerAS12_2351
Enzymes [BR:srs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SerAS12_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2525961..2528021
Genome map
AA seq 686 aa AA seqDB search
MNKFPPLSAKVPGLLHGADYNPEQWANYPGMVEKDVELMTQANCNIMSVGIFSWSKLEPE
EGKYQFAWLDEVLNKLYAQGIHVFLATPSGARPAWLSQKYPEVLRVGRNRVPALHGGRHN
HCLSSPVYRRKVNEINLALAQRYAHHPAVIGWHISNEYSGECHCSRCQSDFRDWLQQRYQ
TLDRLNEAWWSDFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFCSTQATDFCAQEIAP
LKAANPDLPATTNFMEYFYDYDYWQMSKVIDFISWDSYPMWHNRQDETGLACYTAMFHDL
MRSLKQGKPFVLMESTPSVTNWQPISKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVIDHSGRLDTRVGKEVSELGRLLTAMAPVAGSRVEARVAIIFDWESRWAMDDA
QGPRNAGLHYEQTVVEHYRPFWEQGIAVDIINADCDLSGYKLVIAPMLYMVREGFAARAE
AFVRQGGQFVASYWSGIVDESDLCHLGGFPGPLRPLLGIWAEEIDSLTDDETNSIRGVPG
NELGLQGSYQARHLCELINLEGATAQAVYGGDFYAGRPALTVNRFGDGKAWYVASRNDAS
FQRDFFMAIAQQLALPRALDTVLPTSVTAQRRTDGESEFIIVQNYSDKAKTVALPAVYTD
MSNAKTLQGEMTLAPWGCRLLTRKLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttcctcctttgagtgcaaaggtgcctggcctattgcatggagcagactac
aacccggaacaatgggctaattatccgggcatggtggagaaagatgtagagctgatgacg
caggctaactgcaatattatgtcggtagggatattcagctggtcgaagcttgaacctgaa
gagggtaaatatcaattcgcgtggttggacgaggtgctgaataagttatatgcgcagggt
attcacgtatttttggctacgccaagcggcgcgcgtccggcgtggttgtcgcagaaatac
ccggaggtattacgcgtggggcgcaatcgggtacccgcgttgcacggtggccgacacaac
cattgcctgtcatccccggtgtatcgtcgcaaggtgaatgagatcaacctggcgttggct
cagcgctatgcgcaccacccggcggtgatcggctggcatatttccaacgaatacagcggc
gaatgccattgcagccgttgccagagcgatttccgcgattggttgcagcagcgttatcag
acgctggatcggttgaacgaggcctggtggagcgatttctggagccacacctacagtgat
tggtcgcagattgaatcgcccgcgccgcagggtgaggtgtcgattcacggtctgaacctg
gactggcggcgtttttgcagcacccaggccaccgatttctgcgcgcaggaaattgcgccg
ctgaaggcggccaatccagacttgccggccaccaccaactttatggaatatttctacgat
tacgattactggcagatgtcgaaagtcatcgatttcatctcctgggacagctacccgatg
tggcataaccggcaggacgaaaccggcctggcctgctataccgccatgttccacgatcta
atgcgcagcctgaaacagggcaagccttttgtgctgatggaatcgacgccgagcgtcacc
aactggcaaccgatcagcaagctgaagaaaccgggcatgcatattctctcctcactgcag
gcggttgcgcacggagcggattcggtgcagtacttccagtggcgcaaaagccgcggctcg
gtggagaaattccacggtgcggtgattgaccattccgggcggctggatacccgcgtcggc
aaggaggtgagcgagctgggtcggttgttgaccgccatggcaccggtcgccggtagccgg
gtcgaggcgcgggtggcgattatcttcgactgggaaagccgctgggcgatggacgatgcc
caagggccgcgcaacgccgggctgcattacgagcagacggtggtggagcattatcgtccg
ttctgggagcagggcatcgcggtggatatcatcaacgccgattgcgatctctctggttat
aaactggtgattgcgccaatgctgtatatggtgcgcgaaggttttgccgcgcgtgcggaa
gcctttgtccggcagggcgggcagtttgtcgccagctactggagcggcatcgtcgatgaa
agcgatctgtgccatctgggcggtttcccgggaccactgcggccgctgctggggatctgg
gcggaagagatcgacagcctgacggatgacgagaccaacagtattcgcggcgtgccgggc
aatgagctgggtttgcagggcagctatcaggcgcgccatctgtgcgagctgatcaacctg
gagggcgccaccgcgcaggcggtctacggcggtgatttttatgccggccgcccggcgttg
acggtcaaccgctttggcgacggcaaggcgtggtatgtcgcttcgcgcaacgatgcctca
ttccagcgtgatttctttatggcgatagcgcaacagctggcgttgccgcgcgcactggac
acggtattgccgacgagcgtaaccgcacagcggcgcaccgacggtgaatccgagttcatt
atcgtgcagaactacagcgacaaggcaaaaaccgtggcgttgccggcggtgtataccgat
atgtcgaatgccaagactctacagggcgaaatgacgttggccccctggggctgccgccta
ttgacccgcaagttggcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system