KEGG   Serratia sp. AS12: SerAS12_2667Help
Entry
SerAS12_2667      CDS       T01502                                 

Definition
Tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
srs  Serratia sp. AS12
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:srs01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:srs00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:srs00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2870070..2870876
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFKRLESNKEGAFVPFVTLGDPNPALSLQIIDTLVEAGADALELGIPFSDPLAD
GPTIQSAALRAFASGVTPTQCFEMLAAIRQKHPTIPIGLLMYANLVFHKGIDAFYQRCAE
VGVDSVLIADVPFEESAPFRAAATRHGVAPIFICPPNADDDLLREISSHGRGYTYLLSRA
GVTGTESRAQLPLHHLVNKLREYHAAPPLQGFGISEPAQVHDALQAGAAGAISGSAIVKI
IEQNQAQPAEMLTRLANFVSEMKAATRI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatcagcaactgttcaaacgcctggaaagcaacaaggaaggcgccttcgtc
ccgtttgtcaccctgggcgatccgaatccggcactgtcgctgcaaattatcgatactctg
gttgaagccggggccgatgcgctggagctgggcatcccattctccgatccgctggccgac
ggcccgactatacagagcgctgcgttgcgtgccttcgcctccggcgtgacgccgacccag
tgttttgaaatgctggccgccattcgtcagaagcacccgaccattcctatcggcctgctg
atgtacgccaacctggtgtttcataaaggcatcgatgccttttaccagcgttgcgccgaa
gtcggcgtggattcggtgctgattgccgacgtgccatttgaagagtctgcgcccttccgt
gccgccgccacccgccacggcgttgcgcctatctttatctgcccgccgaacgcagacgac
gatttgctgcgtgaaatctcctcacacgggcgaggttatacttacctgctgtcccgcgcc
ggtgttaccggtaccgaaagccgtgcccaactgccactgcatcatctggtgaacaaactg
cgcgaataccatgccgcgccaccgctgcaggggttcggcatttccgagcctgcgcaggtg
catgatgcgctgcaggccggtgccgccggtgcgatctccggttcggcgatcgtcaaaatt
atcgagcaaaatcaggcgcagccggcagaaatgctgactcggctggcgaactttgtcagc
gaaatgaaagccgcgacccgcatctga

DBGET integrated database retrieval system