KEGG   Serratia sp. AS12: SerAS12_2667Help
Entry
SerAS12_2667      CDS       T01502                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
srs  Serratia sp. AS12
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SerAS12_2667
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SerAS12_2667
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SerAS12_2667
Enzymes [BR:srs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SerAS12_2667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
2870070..2870876
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFKRLESNKEGAFVPFVTLGDPNPALSLQIIDTLVEAGADALELGIPFSDPLAD
GPTIQSAALRAFASGVTPTQCFEMLAAIRQKHPTIPIGLLMYANLVFHKGIDAFYQRCAE
VGVDSVLIADVPFEESAPFRAAATRHGVAPIFICPPNADDDLLREISSHGRGYTYLLSRA
GVTGTESRAQLPLHHLVNKLREYHAAPPLQGFGISEPAQVHDALQAGAAGAISGSAIVKI
IEQNQAQPAEMLTRLANFVSEMKAATRI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatcagcaactgttcaaacgcctggaaagcaacaaggaaggcgccttcgtc
ccgtttgtcaccctgggcgatccgaatccggcactgtcgctgcaaattatcgatactctg
gttgaagccggggccgatgcgctggagctgggcatcccattctccgatccgctggccgac
ggcccgactatacagagcgctgcgttgcgtgccttcgcctccggcgtgacgccgacccag
tgttttgaaatgctggccgccattcgtcagaagcacccgaccattcctatcggcctgctg
atgtacgccaacctggtgtttcataaaggcatcgatgccttttaccagcgttgcgccgaa
gtcggcgtggattcggtgctgattgccgacgtgccatttgaagagtctgcgcccttccgt
gccgccgccacccgccacggcgttgcgcctatctttatctgcccgccgaacgcagacgac
gatttgctgcgtgaaatctcctcacacgggcgaggttatacttacctgctgtcccgcgcc
ggtgttaccggtaccgaaagccgtgcccaactgccactgcatcatctggtgaacaaactg
cgcgaataccatgccgcgccaccgctgcaggggttcggcatttccgagcctgcgcaggtg
catgatgcgctgcaggccggtgccgccggtgcgatctccggttcggcgatcgtcaaaatt
atcgagcaaaatcaggcgcagccggcagaaatgctgactcggctggcgaactttgtcagc
gaaatgaaagccgcgacccgcatctga

DBGET integrated database retrieval system