KEGG   Serratia sp. AS12: SerAS12_2741Help
Entry
SerAS12_2741      CDS       T01502                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
srs  Serratia sp. AS12
Pathway
srs00040  Pentose and glucuronate interconversions
srs00052  Galactose metabolism
srs00500  Starch and sucrose metabolism
srs00520  Amino sugar and nucleotide sugar metabolism
srs01100  Metabolic pathways
srs01130  Biosynthesis of antibiotics
Module
srs_M00362  Nucleotide sugar biosynthesis, prokaryotes
srs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SerAS12_2741
   00052 Galactose metabolism
    SerAS12_2741
   00500 Starch and sucrose metabolism
    SerAS12_2741
   00520 Amino sugar and nucleotide sugar metabolism
    SerAS12_2741
Enzymes [BR:srs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SerAS12_2741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 PHZA_PHZB
Motif
Other DBs
NCBI-ProteinID: AEF50812
JGI: SerAS12_2741
Position
complement(2939794..2940711)
Genome map
AA seq 305 aa AA seqDB search
MPAVNRKIRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPKGVTVMQVRQGVAKGLGHAIM
CAYPLVGDEPVAVILPDVILDEYSADLKKDNLHEMLQRFEQTGISQIMVEPVPQKDVGNY
GVADCKGYELQAGESAPMVSVVEKPSPDKAPSNLAIVGRYVLSADIWPLLAKTPPGAGGE
IQLTDSIEMLMQQETVEAYHLKGVSHDCGNKLGYMQAFVEYGLRHASLGKEFSQWLQQLL
VTDKK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtaaatcgtaaaatcagaaaggcagtgatcccggttgcaggcttgggaaca
cgaatgttgccggcgacaaaagccatcccaaaagaaatgttgccgctggttgacaagcca
ttgatccagtacgtggtcaatgaatgcattgcggcagggattaacgagattgtgctggtc
acccattcctccaagaattcgattgaaaaccatttcgataccagttttgagctggaagcg
atgctggaaaaacgcgttaagcgccaattattggatgaagttcagtctatttgcccgaaa
ggcgtcaccgtgatgcaagtgcgtcaaggggtggcgaaaggccttgggcatgccattatg
tgcgcttatccattggtgggcgatgagccggttgccgtaattttgccggacgtgatcctc
gatgagtacagcgccgatctgaaaaaagacaatttgcacgaaatgctgcagcggttcgaa
caaaccggcatcagccagattatggtcgaacctgtgccacagaaagatgtcggcaattat
ggcgtggctgattgcaaaggttatgaactgcaggcgggtgaaagcgctccgatggtcagt
gtggtcgaaaaaccttcgccagacaaagcgccgtcaaacctggctattgttggccgctat
gtgctttctgccgatatttggccgctgctggcgaaaacgcctccaggcgccggcggtgag
atccaacttaccgacagtattgaaatgctgatgcagcaggaaaccgtagaagcctatcac
ctcaaaggggtgagccatgactgcggcaacaagctgggctacatgcaggctttcgtcgag
tatggcctgcgccatgccagccttggcaaagaattttctcagtggttgcaacaactgttg
gtcactgataagaaataa

DBGET integrated database retrieval system