KEGG   Serratia sp. AS12: SerAS12_2756Help
Entry
SerAS12_2756      CDS       T01502                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
srs  Serratia sp. AS12
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SerAS12_2756
Enzymes [BR:srs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SerAS12_2756
    3.5.1.-  
     SerAS12_2756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2955775..2956407
Genome map
AA seq 210 aa AA seqDB search
MKTALLLIDLQNDFCHGGALAVTDGDATVIAANQAIAACVARGEPVVACQDWHPANHRSF
AVNSGTEVNTQGELEGLPQVWWPVHCVQESPGAQLHPQLHRQAIAEVFRKGQNPDIDSYS
AFFDNGHRAQTALDSWLRAQGITHLAIMGLATDYCVKFSVLDALELGYVTSVITDGCRGV
NLQPGDSPKAFQAMELAGAQLVTLSQFIAH
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagccctgttgttaatcgacttgcaaaatgatttttgccacggtggcgcgttg
gcggtgacggacggcgatgccaccgttatcgccgccaatcaggcgattgccgcctgcgtg
gcgcgcggtgaaccggtggtcgcttgccaggactggcaccccgccaatcaccgcagcttt
gcggtgaattcagggactgaggtcaacacgcaaggtgagctggaaggattgccgcaggtg
tggtggccggtgcactgcgtgcaggaaagcccaggggcgcaattgcatccgcagttgcac
cgacaggccattgccgaggtattccgtaaaggccaaaacccggatatcgacagctacagc
gccttttttgacaacggccaccgagcgcaaaccgcgctggacagttggctaagggcgcag
ggcatcactcatctggctatcatggggttggcgaccgattactgcgtgaagttcagcgtt
ctggatgcactggagctgggatatgtgacctcagtgattaccgacggctgccgcggcgtc
aatttacagccaggtgacagcccaaaagcgttccaggcaatggaattggccggagcacaa
ctcgttaccctgtcacaattcatcgcacattga

DBGET integrated database retrieval system