KEGG   Serratia sp. AS12: SerAS12_2761Help
Entry
SerAS12_2761      CDS       T01502                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
srs  Serratia sp. AS12
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS12_2761
Enzymes [BR:srs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SerAS12_2761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2960129..2961004
Genome map
AA seq 291 aa AA seqDB search
MNEKIFTLPVTEQISPYISQRQLEELPVVVVSHPKVRAAVALQGAHLLAWQPAGDKPVIW
LSNNTPFKKGSAIRGGVPICWPWFGPVAQPSHGFARNQPWSLTAHDEDDNGVILTFTLKD
NEQTRKLWPHAFTLIARFKLGEECEIELESHGDYQATAALHTYFQIGDIEQVKVAGLGEP
YIDKVAGGAEARQTGDLAFVGQTDRVYTQPDTFSLIKDPSLQRTIEVHHHHMSDVIAWNP
GVELSCSMADMANDGYKTMVCVETGRVSKPLVAAGEQPARLAVTFRSRKKV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaaattttcaccctgcccgttaccgaacaaatttcaccttacatcagtcaa
cgtcaactcgaagaactgccggtcgtggtcgtttcccacccgaaagttcgcgccgctgtt
gcgctgcaaggcgcacacctgctggcctggcaacctgccggtgataagccggttatctgg
ctgagcaacaacaccccctttaaaaaaggcagcgccattcgcggcggcgtgcctatttgc
tggccctggtttggcccggtagcacaaccctcgcacggtttcgcccgcaatcagccctgg
agcctgaccgcgcacgatgaagacgacaacggtgtcattctgacctttaccctgaaagac
aatgagcaaacccgcaagctgtggccgcatgcctttacgctgattgcccgtttcaaactg
ggtgaagaatgcgagattgagctggagtcacacggcgactatcaggctaccgcagcgctg
catacttatttccagattggggatattgaacaagtaaaagtggcgggcctcggcgaacct
tatatcgacaaagtggccggtggagcagaagctcgccagaccggggacctggcatttgtt
ggtcaaaccgatcgggtttatacccaaccggacactttcagcctgatcaaagatccttca
ctgcaacgcaccattgaggttcatcaccatcatatgagcgatgtgattgcctggaacccg
ggcgtggagctgtcctgcagcatggcagacatggcgaatgacggttataaaaccatggtt
tgcgtggaaaccggccgtgtcagtaaaccgctggtggccgcaggcgaacaaccagcccgg
ctggcggtaaccttccgcagccgtaaaaaggtttga

DBGET integrated database retrieval system