KEGG   Serratia sp. AS12: SerAS12_2761Help
Entry
SerAS12_2761      CDS       T01502                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
srs  Serratia sp. AS12
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:srs00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2960129..2961004
Genome map
AA seq 291 aa AA seqDB search
MNEKIFTLPVTEQISPYISQRQLEELPVVVVSHPKVRAAVALQGAHLLAWQPAGDKPVIW
LSNNTPFKKGSAIRGGVPICWPWFGPVAQPSHGFARNQPWSLTAHDEDDNGVILTFTLKD
NEQTRKLWPHAFTLIARFKLGEECEIELESHGDYQATAALHTYFQIGDIEQVKVAGLGEP
YIDKVAGGAEARQTGDLAFVGQTDRVYTQPDTFSLIKDPSLQRTIEVHHHHMSDVIAWNP
GVELSCSMADMANDGYKTMVCVETGRVSKPLVAAGEQPARLAVTFRSRKKV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaaattttcaccctgcccgttaccgaacaaatttcaccttacatcagtcaa
cgtcaactcgaagaactgccggtcgtggtcgtttcccacccgaaagttcgcgccgctgtt
gcgctgcaaggcgcacacctgctggcctggcaacctgccggtgataagccggttatctgg
ctgagcaacaacaccccctttaaaaaaggcagcgccattcgcggcggcgtgcctatttgc
tggccctggtttggcccggtagcacaaccctcgcacggtttcgcccgcaatcagccctgg
agcctgaccgcgcacgatgaagacgacaacggtgtcattctgacctttaccctgaaagac
aatgagcaaacccgcaagctgtggccgcatgcctttacgctgattgcccgtttcaaactg
ggtgaagaatgcgagattgagctggagtcacacggcgactatcaggctaccgcagcgctg
catacttatttccagattggggatattgaacaagtaaaagtggcgggcctcggcgaacct
tatatcgacaaagtggccggtggagcagaagctcgccagaccggggacctggcatttgtt
ggtcaaaccgatcgggtttatacccaaccggacactttcagcctgatcaaagatccttca
ctgcaacgcaccattgaggttcatcaccatcatatgagcgatgtgattgcctggaacccg
ggcgtggagctgtcctgcagcatggcagacatggcgaatgacggttataaaaccatggtt
tgcgtggaaaccggccgtgtcagtaaaccgctggtggccgcaggcgaacaaccagcccgg
ctggcggtaaccttccgcagccgtaaaaaggtttga

DBGET integrated database retrieval system