KEGG   Serratia sp. AS12: SerAS12_2871Help
Entry
SerAS12_2871      CDS       T01502                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
srs  Serratia sp. AS12
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:srs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3057393..3058007)
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGYILEKQPPLVLLEANGVGYEVHMPMTCFYELPDLGQEAIVFTQFVVREDAQLL
YGFNDKQERALFRELVKVNGVGPKLALAILSGMSAQQFVSAVEREEITTLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNSSEITLPATATQAAELDAEAEAASALVALGYKPQEASR
MVSKIAKPGADCETLIRDALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgataggtcgtctcagaggatatattctggaaaagcagccgccgctggtgttactggag
gcaaacggcgtgggttatgaagtgcatatgcccatgacctgcttttatgagctgccggat
ctggggcaagaagccatcgtgtttacccagtttgtggtgcgcgaagacgcgcagctgctg
tacggtttcaacgataaacaagagcgcgcactgttccgtgagttggttaaagtgaacggt
gtgggaccgaaactggcgctggctatcctgtccgggatgtccgcacagcagtttgtcagc
gcggtagagcgtgaagagatcaccacattggtgaaattgccgggcgtgggcaagaaaacc
gctgagcgcctggtggtcgaaatgaaagaccgctttaaagggcttaatggcgatctgttc
aataacagcagcgaaatcacgctgcccgctacggcaacgcaggcggccgagctggatgct
gaagcagaagccgcttctgcgctggtggcattaggctataaaccgcaggaagccagccgc
atggtcagcaaaatcgccaaaccgggcgccgattgcgaaaccctgatccgcgacgcgctg
cgcgccgccctgtaa

DBGET integrated database retrieval system