KEGG   Serratia sp. AS12: SerAS12_3149Help
Entry
SerAS12_3149      CDS       T01502                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
srs  Serratia sp. AS12
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SerAS12_3149
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SerAS12_3149
   00650 Butanoate metabolism
    SerAS12_3149
  Lipid metabolism
   00071 Fatty acid degradation
    SerAS12_3149
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SerAS12_3149
   00310 Lysine degradation
    SerAS12_3149
   00360 Phenylalanine metabolism
    SerAS12_3149
   00380 Tryptophan metabolism
    SerAS12_3149
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SerAS12_3149
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SerAS12_3149
   00281 Geraniol degradation
    SerAS12_3149
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SerAS12_3149
   00627 Aminobenzoate degradation
    SerAS12_3149
   00930 Caprolactam degradation
    SerAS12_3149
Enzymes [BR:srs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SerAS12_3149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
3340734..3341507
Genome map
AA seq 257 aa AA seqDB search
METPLILQQQQRRVVTLTLHRPEARNALSTPCLEQLVYRLEQADADAGVGAVVIAGAARF
FAAGADLRELQQQDLPAALADRRPLLWQRLAQFSKPLLAAVNGYALGAGCELALACDLII
CGESARFGLPEITLGLIPGAGGTQRLIRCVGKSLACQMVLTGEAINATRALHAGLVSEVC
VDALTLERAQQIAERISLQAPLALRAAKQALKQAEEVGLSQGLAFERQQFVALAATDDRR
EGIAAFFEKRTPNYQGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaaacccctttgatcttgcagcaacagcagcgacgcgtggtcaccctgacgctgcat
cgcccagaggcgcgtaacgccctgagcaccccgtgcctggaacagttggtgtatcggctg
gaacaggccgatgccgacgcaggcgtgggcgcggtggtgatagccggtgccgcgcgcttc
tttgctgcgggcgccgatctgcgggagctgcaacagcaggacctgcccgcagcactggcg
gatcgtcgcccgttgctgtggcagcgactggcgcagttcagtaaaccgctgctggcggcg
gtaaacggctacgcgctcggtgccggctgcgagctggcgctggcctgcgacctcattatc
tgcggcgaaagcgcccgctttggcctgccggaaatcacccttggcctgataccgggagcg
ggtggcacccagcgtttaattcgctgcgtcgggaaatccctggcctgccagatggtgttg
accggtgaagctatcaacgccactcgcgcgctgcatgccgggctggtcagtgaagtgtgc
gtcgacgcgctgacgctggaacgcgctcagcagatcgccgaacgcatcagcttacaggcc
ccgctggcgctgcgtgccgccaagcaggcgctgaaacaggcggaagaagtcggcctcagc
caggggctggcctttgaacgccagcagtttgtcgcactggccgccaccgacgatcgccgt
gaaggcatcgccgccttcttcgaaaaacgtacgccaaactatcaggggcgctga

DBGET integrated database retrieval system