KEGG   Serratia sp. AS12: SerAS12_3260Help
Entry
SerAS12_3260      CDS       T01502                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
srs  Serratia sp. AS12
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SerAS12_3260
  Lipid metabolism
   00600 Sphingolipid metabolism
    SerAS12_3260
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SerAS12_3260
Enzymes [BR:srs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SerAS12_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3469658..3472777)
Genome map
AA seq 1039 aa AA seqDB search
MKQPLYSVNDNPPDSVLPQVLARQDWQNPAVTHLNRLPAHPQFRSWRALEEARDNRRSDR
RVSLDGEWQFVYLAQPEAVDPRWLVADGPDSRPVTVPSNWQMDGYDAPIYTNVRYPISTE
PPFVPQENPTGCYSREIDIPEAWLKAGKTRIIFNGVNSAFHLFCNGVWIGYSQDSRLPAE
FDLTDALHAGGNRICAMVMRWSSGTWLEDQDMWRMSGIYRSVSLLHKPDTHLTDFQLSAG
LDTEYRHGTLQASVHVAAGKAQPAGLQVDLSLWRGDEKIAGQRKPLGTEAIDERGAYADR
VTFALPVQAPDLWSAELPHCYRAVIALYGADGELIEAEAADTGFRRIEITDGLLKVNGKP
LLIRGVNRHEHHPERGQAINEEDMLQDILLMKQNNFNAVRCSHYPNNPRWYELCDRYGLY
VVDEANIETHGMVPMARLSDDPSWFPAYSARVTRMVQCNRNHPSIIIWSLGNESGHGSLH
DALYRWIKSSDPTRPVQYEGGGANSAATDILCPMYARVDEDQLIPGVPKWSIKKWVGMPG
ENRPLILCEYAHAMGNSLGNYDEYWRAFRQYPRLQGGFVWDWADQSLLKDDGNGSRASAY
GGDFNDTPNDRQFCLNGLVFADRTPHPSLHEAKHAQQFFQFSLVGHAPLEVAVGSEYLFR
RTDNERLYWRIEQDGREWRSGEVALDIPPQGNAFVTLAERIDFPANARNVTLILEVIQPE
ATAWSSAGHRVAWQQFRLPTALALPDAPKPGVRPELQLDEDGYRVLHGEQQWFIDRNSGL
LTQWTVAGENTLVSPFTDQFVRAPLDNDIGVSEVERCDPNAWVERWKKAGLYAMQRTCTQ
CTATAYEDRVEIRSTFHYRYGDEVLIVSHWQMMIDGHGALKINVEGERASHLPPLARIGM
VFQAAPASADVEWLGLGPHENYPDRQKSACFSRWRLPLSEMVTPYVFPTENGLRCNTHEL
NWGGWRVDGLFHFSIMSYGSKQLMDVDHWHLLRAEPGIWITLDAQHMGVGGDDSWTPSVH
EEWLLKETQWRYQVSIKHQ
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcctctttattcggtaaacgataacccgccggacagcgttctccctcaggtg
ctggcccggcaggactggcagaacccggccgtcacccacctcaacagattgcccgcccac
ccgcaatttcgcagttggcgcgcgcttgaagaggccagggataatcggcgctccgatcgg
cgcgtttcgctggatggcgaatggcagtttgtttatctggcgcagcccgaggcggtggac
ccgcgctggttggtggcggatggcccggacagccggcccgtaacagtgccttccaactgg
cagatggacggctatgatgcgccgatttacaccaacgtccgctacccgatctcgaccgag
ccgccttttgtgccgcaggagaacccgacggggtgctattcgcgcgaaattgacatccct
gaagcctggctgaaggcaggcaaaacccgaatcatcttcaacggggtgaactcggcgttc
catcttttttgcaatggggtgtggattggctattcgcaggacagccgtttaccggccgag
ttcgatttaaccgacgcgctgcatgccggtgggaaccgtatctgcgcgatggtgatgcgc
tggagctcgggcacctggcttgaggatcaggacatgtggcgcatgagcggcatttaccgc
tcggtgtcattgctgcacaagccggatacccaccttaccgattttcaattgtccgccggg
ctggatacggagtatcggcatggcaccttgcaggcctcggtgcatgttgcggcggggaaa
gcccagccggcggggctgcaggtggatttatccctgtggcgaggcgatgaaaaaatcgcc
ggccaacgcaagccgctgggcaccgaggcgattgacgagcggggggcttatgccgatcgg
gtgacctttgcgttgccggtgcaggcgccggatttatggagcgccgagttaccccattgt
tatcgcgccgtcattgcgctttatggcgccgatggggaactgatcgaagccgaggcggcg
gacaccggttttcgccgcatagagataacggacgggttgctgaaagtgaacggcaagccg
ctgctgatccgtggcgtcaaccggcatgagcaccacccggaacgcggccaggcgatcaac
gaagaggacatgcttcaggatattctgctgatgaagcagaacaactttaatgccgtgcgc
tgttcgcattaccccaataatccgcgctggtacgagctctgtgaccgctacggcctttac
gtggtggatgaggccaatatcgaaacgcacggcatggtgccgatggcgcggctgagtgac
gatccgagctggttcccggcttacagcgcccgcgtgacccgtatggtgcagtgtaaccgc
aatcacccctccatcatcatctggtcgttgggtaatgagtccgggcacggcagtttgcat
gatgcgctttatcgctggattaaaagcagcgatcccacacggccggtccagtacgaaggc
ggcggagccaacagtgcggcaacggatatcctttgcccgatgtatgcccgggtggatgaa
gatcaacttatccctggggtgccaaaatggtcgataaaaaaatgggtcgggatgccgggc
gaaaaccgccccctgatactgtgcgaatacgcccacgcgatgggcaacagcctggggaat
tatgacgagtattggcgtgcgtttcgtcagtatccgcggttgcagggcgggttcgtctgg
gactgggccgatcaatcgttgcttaaagacgatgggaacggctcgcgtgcatcggcctat
ggcggcgacttcaacgacacacccaatgaccggcagttctgcctgaatggcctggtgttt
gccgaccgcacgccacacccttcgctccatgaagcaaaacatgcgcagcagttcttccag
ttttcgttggtggggcatgcgccgctcgaggtggctgtcggcagtgaatacctgttccgc
cgcaccgacaatgaaaggctgtactggcggattgaacaggatgggcgcgaatggcgctcg
ggtgaggtggcgttggacatcccgccacagggaaatgccttcgtcaccctggcggaacgc
atcgattttccggcgaatgcccgcaatgtcactctgatccttgaagttatccagccggaa
gccaccgcctggtcatcggccgggcaccgcgttgcatggcaacaattccggttgccgacg
gcgctggcgttgccggatgcgccaaaacccggcgttcgccccgaactgcagcttgatgaa
gacggttatcgggtgctgcatggcgaacagcaatggtttatcgaccgcaatagcggtttg
ttaacgcagtggacggtggcgggtgaaaacacactggtgagcccgttcaccgaccagttt
gttcgtgcgccgctggataacgacattggggtcagtgaagttgaacgatgcgaccctaac
gcctgggtggaacgctggaaaaaagccgggctttatgcaatgcagagaacctgcacccag
tgtacggcgacggcttacgaagaccgggtggagatccgcagcaccttccattaccgctat
ggcgatgaggtgctgatcgtcagccattggcagatgatgattgatggccacggcgcgctg
aagatcaacgtagaaggggagcgcgcaagccacttgccgccgttggcgcgcatcggcatg
gttttccaggccgcgccggcctccgcagacgtggagtggttagggttggggccgcatgag
aactaccccgaccgccaaaaaagcgcctgtttctcacgctggcgcttgccgttgagcgag
atggtcaccccgtacgtcttccccacggagaatggactgcgttgcaacacccatgagctc
aattggggaggctggcgtgtcgacgggttattccatttctccatcatgtcttacggcagc
aaacagttgatggacgtcgatcattggcatctgttgcgcgccgaacccggtatctggatc
accctggacgcgcagcacatgggcgtggggggcgatgactcctggacgccgagcgtgcac
gaagagtggttgttaaaggaaacgcagtggcgttatcaggtcagtattaagcatcagtaa

DBGET integrated database retrieval system