KEGG   Serratia sp. AS12: SerAS12_3570Help
Entry
SerAS12_3570      CDS       T01502                                 

Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
srs  Serratia sp. AS12
Pathway
srs00071  Fatty acid degradation
srs00280  Valine, leucine and isoleucine degradation
srs00281  Geraniol degradation
srs00310  Lysine degradation
srs00362  Benzoate degradation
srs00380  Tryptophan metabolism
srs00410  beta-Alanine metabolism
srs00640  Propanoate metabolism
srs00650  Butanoate metabolism
srs00903  Limonene and pinene degradation
srs00930  Caprolactam degradation
srs01040  Biosynthesis of unsaturated fatty acids
srs01100  Metabolic pathways
srs01110  Biosynthesis of secondary metabolites
srs01120  Microbial metabolism in diverse environments
srs01130  Biosynthesis of antibiotics
srs01200  Carbon metabolism
srs01212  Fatty acid metabolism
Module
srs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SerAS12_3570
   00650 Butanoate metabolism
    SerAS12_3570
  Lipid metabolism
   00071 Fatty acid degradation
    SerAS12_3570
   01040 Biosynthesis of unsaturated fatty acids
    SerAS12_3570
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SerAS12_3570
   00310 Lysine degradation
    SerAS12_3570
   00380 Tryptophan metabolism
    SerAS12_3570
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SerAS12_3570
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SerAS12_3570
   00281 Geraniol degradation
    SerAS12_3570
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SerAS12_3570
   00930 Caprolactam degradation
    SerAS12_3570
Enzymes [BR:srs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SerAS12_3570
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SerAS12_3570
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SerAS12_3570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEF51630
JGI: SerAS12_3570
Position
complement(3805678..3807843)
Genome map
AA seq 721 aa AA seqDB search
MSFENALHEQRAKPSAFQLTLRPDNIGVITIDVPGDKVNTLKAEFVEQVNDVLIRAQQHT
ALEGLVIISGKPDSFIAGADITMIAACTSAKEAETLAKKGQSTLAQIAAFPVPVVAAIHG
ACLGGGLELALACHGRICSLDDKTALGLPEVQLGLLPGSGGTQRLPRLIGASKALDMMLT
GKHIRARQALRMGLVDDAVPQAILLQTAIERVKQGWQSRRELPWQERLLNGPLGKSLLFS
IVRKKTLEKTHGNYPAAEKIIQVVRTGLDSGSTSGYEAEARAFGELAMTPQSAALRSLFF
ASTALKKERGGNAQPHALHRVGILGGGLMGGGIACVTATRGGLPVRIKDVNETGINHALK
YSWDVLGKRVRSKRMRPAERQKQMMLISGSTDYTGFERVDIVVEAVFEDLALKQNMVAEI
ERHAAPHTIFASNTSSLPIGQIAAKAQRPQQVIGLHYFSPVDKMPLVEVIPHATTSEETI
ATTVALAHKQGKTAIVVADRAGFYVNRILAPYINEAARCLLEGEPIESLDKALVNFGFPV
GPITLLDEVGIDVGTKIIPVLVEQLGPRFAAPAAFDAVLKDGRKGRKNARGFYLYPSEGQ
QRQRGKRADTSVYLLLGITPKSHLQPAVIAQRCVMMMLNEAARCLDEGVIRSARDGDIGA
VFGIGFPPFLGGPFRYMDELGAEKVVKTLQYLQQQYGENFAPCERLQRMAQQGERFYPQG
E
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgaaaacgcattgcatgaacagcgggccaaaccctcggcttttcaactgacg
ctgcgcccggacaacatcggcgtgattaccatcgacgttccgggtgacaaggtcaatacg
ctgaaagccgagttcgtcgagcaggtgaatgacgtcctgatccgcgcgcaacagcatact
gcgctggaagggctggtgattatttccggcaagcccgattcgtttattgccggggcggac
atcaccatgattgccgcctgcaccagtgccaaagaggccgaaacgctggcgaagaaaggg
caaagcacgctggcgcagattgctgctttcccggtgccggtggtggcggctattcacggc
gcttgcctggggggcgggctggagctggctctggcctgccatggtcgcatctgttcgctg
gatgacaaaaccgctctcggcctgccggaagttcagcttggtctgctgccaggctccggc
ggtactcagcgattgccgcgcttgatcggcgccagcaaggcgctggacatgatgctgacc
ggcaagcatatccgtgcgcgtcaggcgctgcggatgggattggtggacgatgcggtgccg
caggcgattttgttgcagaccgccattgagcgggtcaagcagggctggcagagccgacgt
gaactgccgtggcaggaacgcttgctcaacggtcctctggggaaaagcctgttgttcagc
attgtgcgcaaaaaaacgctggagaaaacccacggcaactatccggcagcggaaaaaatc
attcaggtggtgcgtaccggcctggacagcggcagtaccagcggttatgaagccgaagcg
cgggccttcggcgaactggccatgacgccgcagtcggcggcgttgcgcagcctgttcttt
gcctctaccgccttgaagaaagagcgcggcggcaatgcgcaaccccatgcgctgcaccgc
gtcggcattctgggcggtggcctgatgggcggcggaattgcctgcgtgaccgccacgcgc
ggtggcctgccggtgcgaattaaagatgttaatgaaaccggcatcaaccatgcgctgaaa
tacagctgggatgtgcttggcaagcgggtacgcagcaaacgtatgcgtccggcggaacgg
caaaaacagatgatgctgatctccggctcgaccgattacaccggctttgagcgggtggat
atcgtggtggaagcggtgtttgaggatctggccctgaagcagaacatggtggccgagatt
gaacggcacgccgcgccgcataccattttcgcctccaatacctcgtcgttgccgattggc
cagattgccgccaaagcgcagcggccgcagcaggtgatcggcctgcattatttcagcccg
gtcgacaaaatgccgctggtagaggtgatcccccatgccaccaccagtgaggaaaccatt
gccaccaccgtggcgctggcgcacaaacagggcaagacggccattgtggtggccgatcgc
gccggtttctacgtcaaccgcattctggctccttatataaatgaagcggcgcgttgtttg
ctggaaggcgaaccgatcgaatcgctggacaaggcgctggtgaatttcggcttcccggtg
gggccgattaccttgcttgatgaagtgggcattgatgtgggcaccaagattatcccggtg
ttggtggaacagcttggtccgcgtttcgccgcgccggccgccttcgatgcggtactgaaa
gacgggcgcaaagggcgtaaaaatgcccggggtttctacctgtatccgagcgaaggccag
caacgtcagcggggcaagcgcgccgatacctcggtatatcttctgctgggcatcacaccg
aagtcgcatttgcagccggcggtcatcgcccagcgctgcgtgatgatgatgttgaatgaa
gcggctcgttgtctggacgaaggcgtgattcgcagcgctcgtgatggggatatcggcgcg
gtattcggtatcggttttccgccgttcctcggggggccgttccgttatatggacgagctc
ggtgctgagaaggtggttaaaacgctgcaatacctgcagcagcaatacggcgaaaacttt
gccccctgcgaacgcttgcagcgcatggcgcagcagggcgaacgcttttatccgcaaggg
gagtga

DBGET integrated database retrieval system