KEGG   Serratia sp. AS12: SerAS12_4100Help
Entry
SerAS12_4100      CDS       T01502                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
srs  Serratia sp. AS12
Brite
Enzymes [BR:srs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SerAS12_4100
Secretion system [BR:srs02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SerAS12_4100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4385040..4385756)
Genome map
AA seq 238 aa AA seqDB search
MNKGLMLLSLLVASVTGAAHADDAAIKKALGSLGIQQAEVQPSPVNGLKTVLTDNGVLYV
TEDGKHILQGPLYDVSGKEPVNVTNQLLTGKLEALKDQMIVYKAPKEKHVITVFTDITCG
YCHKLHQQMKEYNDLGITVRYLAFPRQGLNSQAEKDMQSIWCTADKAKAFDSAMKGDAVS
PATCKTDISKHYALGVQFGIQGTPAIILENGMMIPGYQGPKEMAAMLDAHQTATKTGG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggtttaatgctgctctctctgctggtggcttcggtgaccggcgcggcccac
gccgacgatgcggcaatcaaaaaagcgctcggcagcctgggcattcagcaggcggaagta
cagccttccccggttaacggcctgaaaaccgtgctgaccgataacggcgtgctgtacgtg
accgaagacggcaaacacattctgcaaggcccgctttacgacgtcagcggcaaagaaccg
gttaacgtcaccaaccaattgcttaccggcaagctggaagcgctgaaagatcagatgatc
gtctacaaagcgccaaaagaaaaacacgtgatcaccgtgtttaccgacatcacctgcggc
tattgccacaagctgcaccagcagatgaaagagtataacgatctgggcattaccgtccgc
tatctggcgttcccgcgccaggggctgaactcccaggccgagaaagacatgcagtcaatc
tggtgcaccgccgacaaggccaaggcttttgattccgccatgaaaggcgatgcagtgtcc
ccggcgacctgtaaaaccgacatcagcaaacactatgcgcttggcgtgcagttcggcatt
cagggcaccccggcgatcattctggaaaacggcatgatgatcccgggctatcaggggccg
aaagagatggccgccatgctggatgcgcatcagaccgcaaccaaaaccggtggttaa

DBGET integrated database retrieval system