KEGG   Serratia sp. AS12: SerAS12_4196Help
Entry
SerAS12_4196      CDS       T01502                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
srs  Serratia sp. AS12
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SerAS12_4196
Enzymes [BR:srs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SerAS12_4196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4488876..4489376
Genome map
AA seq 166 aa AA seqDB search
MIRVYIALGSNLAQPLQQVKAALEALEHLPRTRLILCSSFYRTKPLGPQNQPDFLNAVVA
LDTLLPAEQLLDHTQAIERNQGRVRKDERWGPRTLDLDIMLYGEQVIHTDRLTVPHYGLK
EREFMLYPLAEIAPELVFPDGESLASCLKRVPENGMELWHQPKQKA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgtttatatcgcgctggggagtaacctggcgcaaccgctgcaacaggtaaaa
gccgcactggaggcgctggagcatctcccgcgcacccgattgatcctttgttcgtcgttt
taccgcaccaagccgctggggccgcagaaccagccggactttctcaatgcggtggtggcg
ctcgataccttgctgcccgccgaacaactgctcgatcatacccaagcgatagaacgcaat
cagggccgcgtgcgcaaagatgagcgctggggcccgcgcaccctcgatctggacatcatg
ctgtatggcgagcaggttattcataccgatcgcctgacagtgccgcattacggcctgaaa
gaacgcgagttcatgctctacccgctggcggaaatcgcccccgaattggtgttcccggac
ggcgagtcgttggccagttgcctgaagcgcgtgccggagaacggcatggaactttggcat
cagcccaagcaaaaagcctga

DBGET integrated database retrieval system