KEGG   Serratia sp. AS12: SerAS12_4214Help
Entry
SerAS12_4214      CDS       T01502                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
srs  Serratia sp. AS12
Pathway
srs00010  Glycolysis / Gluconeogenesis
srs00020  Citrate cycle (TCA cycle)
srs00620  Pyruvate metabolism
srs01100  Metabolic pathways
srs01110  Biosynthesis of secondary metabolites
srs01120  Microbial metabolism in diverse environments
srs01130  Biosynthesis of antibiotics
srs01200  Carbon metabolism
Module
srs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS12_4214
   00020 Citrate cycle (TCA cycle)
    SerAS12_4214
   00620 Pyruvate metabolism
    SerAS12_4214
Enzymes [BR:srs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SerAS12_4214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H NQRA HlyD_D23 DUF1223
Motif
Other DBs
NCBI-ProteinID: AEF52262
JGI: SerAS12_4214
Position
complement(4508264..4510153)
Genome map
AA seq 629 aa AA seqDB search
MSIEIKVPDIGADEVEITEILVKVGDKVEVEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGKLLMIFEAEGAAAAAPAAKAEEKPAAAPAAAPAAAAAKDVAVPDIGADEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKIGAGDKVKTGSLIMVFEVA
GAASAAAPAAVEAPAAPAAPAAAAAKDVAVPDIGGDEVEVTEVMVKVGDKVAAEQSLITV
EGDKASMEVPAPFAGTVKEIKISAGDKVKTGSLIMVFEVEGAAPAAAPAQKAEAAPAPAK
QEAAAAAPTAKAESKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQ
TYVKDAVKRAEAAPTAAAGGGLPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWV
MIPHVTHFDKTDITDLEAFRKQQNDEAAKRKLDVKFTPVVFIMKAVAAALEQMPRFNSSL
SEDGQKLTLKKYINVGVAVDTPNGLVVPVFKDVNKKSITELSRELMAISKKARDGKLTAG
EMQGGCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFMPRLMMPMSLSF
DHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgaaatcaaggtaccggacatcggtgcagacgaagtggaaatcaccgaaatt
ctggtgaaagtgggcgataaagttgaagttgaacaatcgctgatcaccgttgaaggtgat
aaagcttccatggaagtcccgtccccgcaagcgggcgtggtgaaagagatcaaggtgtcc
gtcggtgataaaaccgaaaccggcaaactgctgatgatctttgaagcagaaggcgcggca
gctgccgcaccagccgccaaagcggaagaaaaaccggccgcagcacctgctgctgcaccg
gctgccgctgctgccaaagacgttgcggtaccggacatcggcgccgacgaagtagaagtg
accgagatcctggtgaaagtgggcgacaaggtggaagccgagcagtccctgatcaccgtg
gaaggcgacaaggcttccatggaagtccctgcaccctttgcgggcaccgtgaaagagatc
aaaatcggcgccggcgacaaagtgaaaaccggttccctgatcatggtcttcgaagtggcc
ggcgcagcttctgctgccgctccggctgcggttgaagcccctgcggcaccagccgccccg
gctgccgccgctgccaaagacgttgccgtgccggatatcggcggcgatgaagtggaagtg
accgaagtgatggtgaaagtgggcgacaaagttgccgctgagcagtcgctgatcaccgtt
gaaggtgacaaggcttctatggaagtgccggcaccgttcgcaggtaccgtgaaagaaatc
aaaatcagcgctggcgacaaagtgaaaaccggctctctgatcatggtgttcgaagttgaa
ggcgcggcaccagccgccgctccggcccagaaagcagaagctgcaccggctccggccaag
caggaagccgctgcggccgctccaactgccaaagcggaaagcaaaggcgagttcgcagag
aacgacgcttacgtgcatgcaaccccggtcatccgtcgtttggcgcgtgaattcggcgta
aacctggcgaaagtgaaaggcaccggtcgtaaagggcgcatcctgcgcgaagacgtccag
acttacgtgaaagacgcagtcaaacgtgcagaagcggctccaaccgctgctgccggtggc
ggtctgccaggcatgctgccatggccgaaagtggacttcagcaagttcggtgagattgaa
gaagttgaactgggccgcatccagaagatttcgggtgccaacctgagccgcaactgggtg
atgatcccgcacgtgactcacttcgacaaaaccgatatcaccgatctggaagcgttccgc
aagcaacagaacgatgaagcggccaaacgtaagctggatgtgaagttcacccctgtggtg
ttcatcatgaaagccgtcgccgccgctctggagcagatgccgcgcttcaacagctctctg
tccgaagatggccagaagctgacgctgaaaaaatacatcaacgtcggtgttgcggttgat
acgccaaatggtctggtggttccggtattcaaggatgtgaacaagaaaagcatcactgag
ctgtcccgcgagctgatggctatctccaaaaaagcgcgtgacggcaagttgaccgcaggc
gaaatgcagggcggttgcttcaccatctccagcctgggcggtatcgggacaactcacttc
gcgcctatcgtcaacgcgccggaagtggctatcctgggtgtctccaagtctgcgatggag
ccggtctggaacggtaaagagttcatgccgcgtctgatgatgccgatgtcgctctccttc
gaccaccgcgttatcgacggtgcagatggtgcgcgtttcatcaccatcatcaacaatatg
ctgtctgacatccgccgtctggtgatgtaa

DBGET integrated database retrieval system