KEGG   Serratia sp. AS12: SerAS12_4363Help
Entry
SerAS12_4363      CDS       T01502                                 

Definition
beta-galactosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
srs  Serratia sp. AS12
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:srs00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4707085..4708488)
Genome map
AA seq 467 aa AA seqDB search
MSVFPKDFLWGAATASYQVEGGHDADGKGLSNWDLFSHLPGTTYQGTNGDVAVDHYHRFR
EDVALMAELGMQTYRFSISWPRLLPQGRGEVNEAGIRFYSELIDELLKHNIKPMITLYHW
DLPQALQEQFGGWESREIVDAFDEYARLCYQRFGDRVELWSTFNETIVFIGMGYITGAHP
PRLTDPKKGIQACHHVFLANARAVKSFREMGIDGQIGFVNVLQPNDPISDSPQDRRACEI
AEGIFTHWLYDPVLKGEYPAELLAMAQQAFGVPYFAPGDEELLKQNIVDFIGLNYYKREM
VAHNDDVDGYAINTSGQKGSGRELGFKGLFKQVRNPNGVYTDWDWEVYPQGLTDAIGRIV
KRYGNIPLYITENGLGAKDPIVDGEVRDQPRIDYLRDHIQAIGAAIEQGADVRGYYPWSF
IDLLSWLNGYQKQYGFVYVDHNDNLARKKKQSFGWYQRVIATNGEQL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtatttccaaaggatttcctctggggcgcggcgaccgcgtcttatcaggttgag
ggcggccatgatgccgacggcaagggcttgtccaactgggatctgttttcccatctgccc
ggtactacctatcagggcaccaacggcgacgtggcggtcgatcactatcatcgcttccgg
gaagacgtggcgctgatggccgagctgggcatgcaaacctatagattttcgatctcctgg
ccgcggctgctgccgcaggggcggggagaggtgaacgaggccgggatccgcttctacagc
gaacttatcgacgaactgctgaagcacaatatcaaacctatgatcaccctttatcactgg
gatctgccgcaggctttgcaggaacagttcggcggctgggaatcgcgtgagatcgtcgac
gccttcgatgaatacgcccgcctgtgctatcagcgctttggcgatcgcgtcgagctgtgg
tcaaccttcaacgaaaccattgtgtttatcggcatgggctacattaccggcgcacatcca
cccaggctgaccgatccgaaaaagggcattcaggcctgccaccacgtgtttctggccaat
gcgcgggcggtgaaaagcttccgcgaaatggggatcgacgggcagatcggcttcgtcaac
gtattgcaacctaacgatccgatcagcgactcgccgcaggatcggcgcgcctgcgagatt
gccgaagggatcttcacccactggctgtacgatccggtgctgaagggagaatacccggca
gagctgctggcgatggcgcagcaggcgtttggcgtgccgtatttcgcgccgggtgatgag
gagcttctgaagcagaacatcgtcgattttatcggcctgaattactacaagcgtgagatg
gtggcgcataacgacgacgtggacggctatgccatcaacaccagcggccagaagggcagt
gggcgcgaactgggctttaaggggctttttaaacaggtacgcaacccgaacggcgtttac
accgattgggattgggaggtttacccgcaagggctgaccgacgccattggccgcatcgtc
aaacgctacggcaatattcccctctacatcaccgagaacgggctgggggccaaggatccg
attgtcgacggcgaggtgcgcgatcaaccgcgcattgattatctgcgcgatcatattcag
gcgatcggcgcggcgatcgaacagggtgccgacgtgcgcggctattacccctggtcgttt
atcgatctgctttcctggctcaacggctatcagaagcaatacggtttcgtctatgtcgat
cataacgacaatctggcgcgcaagaagaagcagagctttggctggtatcagcgggtgatc
gccaccaacggcgagcagctatag

DBGET integrated database retrieval system