KEGG   Serratia sp. AS12: SerAS12_4394Help
Entry
SerAS12_4394      CDS       T01502                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
srs  Serratia sp. AS12
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:srs00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:srs00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:srs02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4741960..4743492
Genome map
AA seq 510 aa AA seqDB search
MFRSTLATHLALSATLCTGWVATVCAEEKAQLVQREDPYFKQAQEQLQQRLAQPKNTHRA
KNVILVVGDGMGFSTVTAARIFEGQQRRVDGESNVLAWEAFPYLAAAKTYSANAQITDSA
PSAVAMTTGVKTLNDLMGLDHTASLNNCEDQKTKTVTTLWEMAASLGMSTGAVTTATITH
ATPGATYAHIANRDWESDAKMPAEALAAGCSDIARQLVEMKYGNGLNVAMGGGRANFLPE
SATDPEYSAKKGNRKDGRDLTQAWLKRYGERGSYVWNQAQFDRIDSTKVDHLLALFEPSH
MNFDHDRREDAAGEPSLAEMTGKAIDILARNPEGYLLLVEGGRIDHGSHNGNAYRTLTDT
VALNEAVKTVIGKVDLNETLVVVTGDHSHTLTLAGYAKRGNPILGISIGVNGKPLLGSDG
KPYTTVSFANGPGGVIPLPERPALTMEQASVPDFIQPALVPMKSETHGGEDLGIYAIGPW
SHLFQGTVEENYTFHVMNHASRIGERLSNL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgttcagatccacactggcaacccacctggctctttccgctaccttatgcaccgggtgg
gtagcaaccgtctgcgcagaggaaaaagctcaactggtacagcgcgaagatccttacttc
aaacaggcgcaggaacagctgcaacaaaggctggcacagcctaagaatacccatcgggcg
aaaaacgtcattctggtcgttggcgacggaatggggttttcaaccgttaccgcagcacgc
attttcgaagggcaacaacgcagagtcgacggcgaatctaacgtgttggcatgggaagcc
ttcccctacctggctgcagccaaaacttactctgccaatgcccagataaccgactccgcc
cccagcgcagtcgccatgaccaccggcgtcaaaaccctcaatgacttgatggggctggac
catacggcgagccttaacaactgcgaggatcagaaaaccaaaacggtcaccaccctgtgg
gagatggccgcctccctcggcatgtccaccggagccgtcaccaccgcgaccatcacccat
gccactcccggcgccacctatgcccatatcgctaaccgagactgggagtccgatgcaaaa
atgccggccgaagccctggccgccggctgcagcgatattgctcgtcagttggttgagatg
aaatacggcaacggcctcaacgtcgccatgggcggcgggcgcgccaacttcctgccggag
agcgcaaccgaccctgaatactccgctaaaaaaggcaacaggaaggatggtcgtgacctg
acgcaagcctggctaaaacgctatggtgaacgcggcagctacgtgtggaatcaagcgcag
ttcgatcggatcgactccacgaaggttgatcatctgttggccctgtttgaaccgtcacat
atgaacttcgaccacgatcggcgggaagatgccgcaggtgagccttctctggccgaaatg
accggtaaggccatcgatattctggccagaaaccccgagggctatctgttgctggttgag
ggcgggcgtattgaccacggcagccataacggcaatgcctatcgcaccctgaccgatacg
gtggccctcaatgaagcggtaaaaaccgttatcggcaaagttgacctgaacgagacgctg
gtggtggtgaccggcgatcatagccatacgctcacccttgccggctatgccaaacggggc
aatccgatcctcggcatctcaattggcgtcaacggcaaaccgctgctgggcagcgacggc
aagccctataccacggtcagcttcgccaacggccccggcggtgtcattccgctaccggag
cgcccagcactcaccatggagcaggccagcgtacccgactttatccagccggcgctggtg
ccgatgaagagcgaaacgcatgggggggaggatcttggcatctacgccatcggcccttgg
tcgcatctgttccagggcacggtcgaggagaactacacgtttcatgtgatgaaccacgcc
agccgtatcggcgaacgtctgtcaaatctgtag

DBGET integrated database retrieval system