KEGG   Serratia sp. AS12: SerAS12_4600Help
Entry
SerAS12_4600      CDS       T01502                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
srs  Serratia sp. AS12
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:srs01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:srs00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4979387..4980694)
Genome map
AA seq 435 aa AA seqDB search
MSTSRTQQIQQLEQEWKSARWEGITRPYSAEDVINLRGSVNPVCTLAQNGAAKLWDLLNG
KSRKGYVNCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTATAMYPDQSLYPVDSVPT
VVERINNTFRRADQIQWSNKIEPGSKDYTDFFLPIVADAEAGFGGVLNAYELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDADAAD
LLTSDCDPYDSEFVSGERTAEGFFRTHAGIEQAISRGLAYSPYADMVWCETSTPDLQAAK
RFADAIHAKFPGKLLAYNCSPSFNWKKNLDDQTIARFQEELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQEPEFAAVARGYTFASHQQEVGTGYFDKVTTIIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctcacgtactcaacagattcaacagctggaacaggaatggaaatcggcccgt
tgggaaggcatcactcgcccatacagcgccgaagacgtgatcaacctgcgtggctcagtc
aacccggtttgcactctggcgcagaacggcgctgccaaactttgggatctgctgaatggt
aaatcacgcaaaggctacgttaactgcctgggtgcgctgactggcggccaggcgttgcag
caggccaaagcgggtgtcgaggcgatttacctgtctggctggcaggtggcggcggatgcc
aacaccgcgaccgcgatgtacccggaccagtcgctgtacccggtggactcggtaccgacg
gtggttgagcgtatcaacaacactttccgccgcgccgatcagatccagtggtccaacaag
attgaaccgggcagcaaagattacaccgatttcttcctgccgatcgtcgccgatgcggaa
gccggctttggcggcgtattgaacgcctacgaactgatgaaagcgatgattgaagccggt
gccgccggggtgcatttcgaagaccaactggcggcggtaaaaaaatgcggccatatgggc
ggcaaagtgctggtgccaacccaggaagcgattcagaagctggttgccgcgcgtctggcg
gccgacgtactcggcgtgccgacgctggtgattgcgcgtacggatgccgatgcggctgat
ttgctgacgtccgattgcgatccttacgatagcgaattcgtttccggtgaacgcaccgcc
gagggctttttccgcacccatgccggcatcgaacaggcgatcagccgcggactggcctac
tccccttatgcggacatggtgtggtgtgaaacttcaaccccggatctgcaagcggccaag
cgtttcgccgatgcgatccatgccaaattcccgggcaagctgctggcatacaactgctcg
ccgtcgttcaactggaaaaagaacctggacgatcagactatcgctcgcttccaggaagag
ctgtccgcgatgggctacaaataccagttcattaccctggccggcatccacagcatgtgg
ttcaacatgttcgatctggcgcacgcctacgcgcagggtgaaggcatgaaacactacgtc
gagaaggtgcaagagccggaattcgccgccgttgcacgtggctacacctttgcctcacac
cagcaggaagtaggcaccggctacttcgataaagtcaccaccatcattcaggggggcgca
tcttcagtgaccgcgctgaccggttcgacggaagagcaacagttctga

DBGET integrated database retrieval system