KEGG   Serratia sp. AS12: SerAS12_4895Help
Entry
SerAS12_4895      CDS       T01502                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
srs  Serratia sp. AS12
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:srs00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5300260..5301768
Genome map
AA seq 502 aa AA seqDB search
MTVEKKYIVALDQGTTSSRAVVLDHDANIVAVSQREFTQIYPKAGWVEHDPMEIWSSQSS
TLVEVLAKADINSDQIAGIGITNQRETTIVWEKETGKPIYNAIVWQCRRTADICEKLKRD
GLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARERAKRGELLFGTVDTWLVWKMTQGRV
HVTDYTNASRTMMFNIHELDWDDRMLEALDIPRVMLPKVRPSSEVYGQTNIGGKGGTRIP
IAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFLLMNTGKEAVRSNHGLLTTIACGPRGEV
NYALEGAVFIGGASIQWLRDELKLISDAADSEYFATKVKDSNGVYVVPAFTGLGAPYWDP
YARGAIFGLTRGANSNHIIRATLESIAYQTRDVLDAMQADSNTRLQSLRVDGGAVANNFL
MQFQSDILGTRVERPEVRESTALGAAFLAGLAIGYWNDLDEVKSKAVIEREFRPSIETTE
RNFRYSGWKKAVARAQAWEDHD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacagtagaaaaaaaatacattgtcgctctcgaccagggaaccaccagttcacgtgcc
gtagtgctcgatcacgatgccaatattgttgcggtatctcagcgcgagttcacgcagatt
tacccgaaagccggctgggttgaacacgatccgatggagatctggtcgtcacaaagctcc
acgctggtggaagtgctggcaaaagccgacatcaattccgatcagattgccggcatcggc
atcaccaaccagcgtgaaaccaccatcgtctgggaaaaagagaccggcaagccgatttac
aacgccatcgtctggcaatgtcgccgcaccgccgacatctgcgaaaagctcaagcgcgat
ggcctggaagagtacattcgtcacaacaccggcctggtggttgacccgtacttctccggc
accaaggtgaagtggatcctcgataacgttgaaggtgcccgtgaacgcgccaagcgcggc
gaactgctgttcggtaccgtcgacacctggctggtgtggaaaatgacccagggacgggtg
catgtgaccgattacaccaacgcctcgcgcaccatgatgtttaacatccatgagctggac
tgggacgatcgcatgctggaagcgttggatattccacgcgtcatgctgccgaaagtccgc
ccgtcctctgaggtgtacggccagaccaatatcggcggtaaaggcggcacgcgtattcct
atcgccggtatcgccggtgaccagcaggcggcgctgtacggccaactgtgcgttcaaccg
ggtatggcgaagaacacctatggcaccggctgcttcctgctgatgaacaccggcaaagaa
gcggtacgttccaaccacggcctgctgaccaccatcgcctgcggcccgcgcggtgaagtg
aactatgcgctggaaggcgcggtatttatcggcggtgcctccatccagtggctacgcgat
gagttgaaactgatcagcgatgcggccgactccgaatacttcgccaccaaggtgaaagac
agcaacggcgtctacgtagtaccggccttcaccggcctgggtgccccttactgggaccca
tatgcccgtggcgctatcttcggcctgactcgtggtgcgaacagcaaccacatcatccga
gccacgctggagtccatcgcctaccagacgcgcgacgtgctcgacgccatgcaggccgac
tccaacacccgcctgcagtcgctgcgtgtggacggtggcgcagttgccaacaacttcctg
atgcagttccagtccgacattctcggtacccgtgtggagcgtcctgaagtgcgcgaatcg
acggctctgggtgcagccttcctggcgggcctggccattggctactggaacgatctggat
gaggtgaagagcaaagccgttatcgagcgtgagttccgcccaagcattgaaaccaccgag
cgtaacttccgctacagcggatggaaaaaagcggtagcccgcgcccaggcatgggaagat
cacgactaa

DBGET integrated database retrieval system