KEGG   Serratia sp. AS12: SerAS12_4902Help
Entry
SerAS12_4902      CDS       T01502                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
srs  Serratia sp. AS12
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SerAS12_4902
   01230 Biosynthesis of amino acids
    SerAS12_4902
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS12_4902
   00051 Fructose and mannose metabolism
    SerAS12_4902
   00562 Inositol phosphate metabolism
    SerAS12_4902
Enzymes [BR:srs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SerAS12_4902
Exosome [BR:srs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SerAS12_4902
  Exosomal proteins of bladder cancer cells
   SerAS12_4902
  Exosomal proteins of melanoma cells
   SerAS12_4902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
5307147..5307914
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAALRNELSSVDGCGVAIAPPVMYLDQAKHALAGSRIA
LGAQNVDVNLSGAFTGEVSADMLKDVGAQYIIIGHSERRTYHKETDAAIAEKFAVLKAAG
LIPVLCIGETDAENEAGKTEEVCARQIDAVLKTQGAEAFKGTVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAEVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattagttatgggtaactggaagcttaacggcagcactcacatggttaac
gaactcattgccgctctgcgcaatgaactgagcagcgttgacggttgtggcgtggctatc
gcaccgccggtgatgtacctggatcaggccaagcacgctctggccggcagccgcattgct
ctgggcgctcaaaatgtagacgtgaacctgtccggtgcattcaccggcgaagtttccgct
gacatgctgaaagatgtaggcgcgcaatacatcatcatcggccactccgaacgtcgcact
taccacaaagaaaccgacgctgcgatcgccgaaaaatttgccgtgctgaaagcggctggt
ctgatcccggtgctgtgcatcggtgaaaccgatgcagaaaacgaagcgggtaaaaccgaa
gaagtttgcgcacgccagatcgacgccgtgctgaaaacccagggcgcggaagcgttcaaa
ggtaccgttatcgcttatgagccagtttgggccatcggtaccggcaaatcagctactcct
gcgcaggcacaggcagtacacaaatttatccgcgatcacatcgccaagcaggacgcagcc
gtagctgcagaagtgattatccagtacggcggctctgtgaacgataagaatgctgccgag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcatcactgaaagctgac
gctttcgccgtgatcgtcaaagccgctgcagccgctaaaaaagcctga

DBGET integrated database retrieval system