KEGG   Serratia sp. AS12: SerAS12_4937Help
Entry
SerAS12_4937      CDS       T01502                                 

Definition
fomramidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
srs  Serratia sp. AS12
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:srs00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SerAS12_4937
Enzymes [BR:srs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SerAS12_4937
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SerAS12_4937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5342006..5342815)
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPYLVGHSIQYAVVRNARLRWPVSEQILALSDRPVRSVQRRAKYLL
IELDHGWIIVHLGMSGSLRMLAEETEAGKHDHVDLVISNGMTLRYTDPRRFGAWLWCEDL
ANSNVLAHLGPEPLSEAFTGAYLYEKSRNKRTLIKPWLMDNKLVVGVGNIYASESLFTAG
ILPDRPAGSLSKTEAELLVETIKAVLLRSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRA
GEPCRACGTPIESAKHGQRSTFFCRRCQR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaagttgagaccagccgacgtggtattgaaccttatcttgtcggc
catagcattcagtatgcggtggtgcgcaacgcgcggctgcgctggcctgtttccgagcaa
attctggcgctgagcgaccggccggtacgcagcgtgcaacgccgcgccaagtatctgctg
attgaactggaccacggctggattatcgtccatttggggatgtccggcagcctgcgtatg
ctggccgaggaaaccgaagccgggaagcacgaccatgttgatctggtgatcagcaacggc
atgacgctgcgttataccgatccccgtcgttttggcgcctggctgtggtgcgaagatttg
gcgaacagcaatgtgctggcccaccttgggccggaaccgctaagtgaagcctttactggc
gcctacctgtacgaaaagtcacgcaataagcgcacgttgatcaaaccctggctgatggat
aacaagctggtcgtgggggttggcaatatctacgccagcgaatcactgtttaccgccggg
atcctgcccgatcgcccggccggttcgctgagcaaaacggaagctgagctgctggtggaa
accattaaagcggtattgctacgctcgattgagcaaggtggcaccacgctgcgcgatttc
ctgcagtcggacggtaaaccgggctatttcgcgcaagaattgcaggtgtatggtcgtgcg
ggggagccttgccgcgcgtgcggcacgccgattgaatcagctaaacacgggcagcgcagc
accttcttctgccgccgctgccaacgctga

DBGET integrated database retrieval system