KEGG   Segniliparus rotundus: Srot_0192Help
Entry
Srot_0192         CDS       T01238                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
srt  Segniliparus rotundus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Srot_0192
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Srot_0192
Enzymes [BR:srt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Srot_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(173121..173621)
Genome map
AA seq 166 aa AA seqDB search
MSTLLDTPVTTLHGQSTTLRELAQPSGPVLVVNVASKCGLTPQYKALEELAENYGPKGLT
VVGVPCNQFGGQEPGSAEEIQTFCSTTYGVTFPLLEKAEVNGEGQHPLYRELVQKADAEG
HAGAVQWNFEKFLIAPDGSVSARFRPTTAPQAPELTAAIEALLPGA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagcactctcctcgacacgcccgtcacgacactgcacggccaatcgaccacgctgcgc
gagttggcgcagccgtccggcccggtcctcgtcgtcaatgtcgcctccaaatgcgggctg
accccacagtacaaagccctcgaagagctggcggaaaactacggccccaaagggctgacc
gtcgtcggcgtgccctgcaaccagttcggcggacaagagcccggttcggccgaggaaatc
cagacgttctgctccaccacctatggcgtgacattccccttgctcgaaaaagccgaggtc
aacggcgaagggcaacacccgctgtatcgcgaactcgtgcagaaagccgacgccgagggc
cacgcgggcgctgtgcagtggaacttcgagaagttcctgatcgcgccggacggctccgtc
tcggcccgattccgcccgacgaccgcgccgcaggccccagagctgaccgccgcgatcgaa
gcattgctgcccggcgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system