KEGG   Segniliparus rotundus: Srot_0314Help
Entry
Srot_0314         CDS       T01238                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
srt  Segniliparus rotundus
Pathway
srt00071  Fatty acid degradation
srt00280  Valine, leucine and isoleucine degradation
srt00281  Geraniol degradation
srt00310  Lysine degradation
srt00360  Phenylalanine metabolism
srt00362  Benzoate degradation
srt00380  Tryptophan metabolism
srt00410  beta-Alanine metabolism
srt00627  Aminobenzoate degradation
srt00640  Propanoate metabolism
srt00650  Butanoate metabolism
srt00903  Limonene and pinene degradation
srt00930  Caprolactam degradation
srt01100  Metabolic pathways
srt01110  Biosynthesis of secondary metabolites
srt01120  Microbial metabolism in diverse environments
srt01130  Biosynthesis of antibiotics
srt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Srot_0314
   00650 Butanoate metabolism
    Srot_0314
  Lipid metabolism
   00071 Fatty acid degradation
    Srot_0314
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Srot_0314
   00310 Lysine degradation
    Srot_0314
   00360 Phenylalanine metabolism
    Srot_0314
   00380 Tryptophan metabolism
    Srot_0314
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Srot_0314
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Srot_0314
   00281 Geraniol degradation
    Srot_0314
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Srot_0314
   00627 Aminobenzoate degradation
    Srot_0314
   00930 Caprolactam degradation
    Srot_0314
Enzymes [BR:srt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Srot_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADG96801
UniProt: D6ZB42
Position
complement(285949..286998)
Genome map
AA seq 349 aa AA seqDB search
MPDESHSGQRPAAWREGLREGPHAPFADRPEPDNAGARYKTLTYETTGRVARIVFNRPER
GNAITPDTPLDLAAAVERADLDPRVHVILVSGRGKGFCGGYDLDMFAENGGTSDAGAHET
APGAADNRAARAGTVLDPVAQAVNHNPWGVWDPMLDYAMMSRFNRGFASLLHANKPTVAK
LHGFCVAGGTDIALYADQIICASDTKIGYPPTRVWGVPAAGMWAHRLGDQRAKRLLLTGD
CISGKQAEEWGLAVEAPEPDELDECAENLVERIAMMPINQLMMVKLALNSALINQGVANS
TMVSTVFDGISRHTREGYAFQLRSMTAGFREAVRERDEPFGDHKRAQFE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgagtctcacagcggccaacgtcccgcggcgtggcgggagggtttgcgcgag
gggcctcacgcgccgttcgccgaccggccggagccggacaacgcaggggcgcgctacaag
accttgacctatgagacaaccgggcgggtcgcgcggatcgtgttcaaccgccccgaacgg
ggcaacgcgatcacccccgacactcccctcgacctcgcggccgctgtggagcgcgccgac
ctcgacccccgcgtgcacgtcatcctcgtgtccgggcgcggcaagggcttctgcggcggt
tacgacctggacatgttcgccgaaaacggcgggacgtcggacgcgggggcgcacgaaacg
gcccctggcgcggcggacaaccgggccgcgcgcgccgggaccgtcttggaccctgtcgcc
caagcggtcaaccacaacccctggggggtctgggaccccatgctcgactacgccatgatg
agccgcttcaaccgaggcttcgccagcctcctgcacgcgaacaagcccaccgtcgcgaaa
ctccacggcttctgcgtcgcaggcggcaccgacatcgccctctacgccgaccagatcatc
tgcgcctcggacaccaaaatcggttacccgcccacccgcgtttggggcgtccccgccgcc
ggcatgtgggcccaccgtctcggggaccaacgcgccaaacgcctcctgctcaccggcgac
tgcatcagcggcaagcaagccgaggaatggggcttggccgtggaagcccccgaacccgac
gaactcgacgagtgcgccgaaaacctcgtcgaacgtatcgcgatgatgccgatcaaccag
ctcatgatggtcaaactcgcgctcaacagcgcgttgatcaaccagggggtcgccaactcc
acgatggtctccaccgtcttcgacggcatttcccggcacacccgcgagggctacgccttc
cagttgcgttcgatgacggcgggattccgcgaggcggtccgcgagcgcgacgagcccttc
ggcgaccacaagcgggcgcagttcgaatga

DBGET integrated database retrieval system