KEGG   Segniliparus rotundus: Srot_0421Help
Entry
Srot_0421         CDS       T01238                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
srt  Segniliparus rotundus
Pathway
srt00790  Folate biosynthesis
srt01100  Metabolic pathways
Module
srt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Srot_0421
Enzymes [BR:srt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Srot_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI Pyr_redox_2 UPF0020
Motif
Other DBs
NCBI-ProteinID: ADG96908
UniProt: D6ZBT1
Position
404802..405395
Genome map
AA seq 197 aa AA seqDB search
MESFEQTKSAFDDNRAEAAVRELLIAVGEDPDRPGLSRTPARVAKLYRELFSGLEQNPED
VLGESFAADHDELVLVKDIRVQSVCEHHLLSFHGNAHVGYIPGVGGSVVGFSALSRLVDL
YARRPQIQERLTSQVADALMEHLRPRGVIVVVEAEHLCMQVRADRQQSARVTTSAVRGLL
RTNPSSRAEALGFILRA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggagagcttcgagcagaccaagtcggcttttgacgacaacagggcagaagcggctgtc
cgagaattgctcatcgccgtcggcgaggacccggaccgcccagggttgtccagaacgccc
gcgcgggtcgcgaagctgtaccgtgagttgttctcggggttggagcagaaccccgaagac
gtgctcggggagagcttcgccgccgaccatgacgaactggtgctggtcaaagacatccgc
gtgcagtcggtctgcgagcaccaccttctgtcgttccacgggaacgcgcatgtcggctac
atccccggcgtcggcggctcggtggtgggattctccgcgctttcccgcctcgtcgacctc
tatgcccgccgcccgcaaatccaagagcgattgacctcgcaggtagccgacgcgctcatg
gagcacctgcgcccgcgcggcgtcattgtcgtggtggaggccgagcatctgtgcatgcag
gtccgcgccgaccgccagcagtccgcgcgggtgacgacgtcagcggtccgcggactgctc
cgcaccaatccgtcgtctcgggcagaagccttgggcttcatcctccgcgcatga

DBGET integrated database retrieval system