KEGG   Segniliparus rotundus: Srot_0424Help
Entry
Srot_0424         CDS       T01238                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
srt  Segniliparus rotundus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:srt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406776..407309
Genome map
AA seq 177 aa AA seqDB search
MTTAVLSLGSNLGNRLGFLQLAVASLGDRVLAASSVYETDPWGTAGPNFFNAVLMASDPA
LDARGWLDEAFRAEALAGRTRETVWGPRTLDVDVIACYDEDGAPVVVDEPTLSVPHPRAH
QRAFVLVPWLQVQPQARLAVGGEDISVRELIAQLAQAERASVRHTPLTLSAFTAHVS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggcagtgctttctctcgggtccaatctcggcaaccggctgggttttttgcag
ctcgccgttgcctcgctcggcgacagggtgctcgcggcctcttcggtgtacgagacagac
ccgtggggcacggccggcccgaacttcttcaacgcggtgctcatggcgtccgatcctgcg
ctcgacgcgcggggctggttggacgaggcgtttcgggctgaggcgctcgcggggcgcacg
cgcgagacggtctgggggcccaggacgctcgatgtggacgtgatcgcctgctatgacgag
gacggggcccccgtcgtggtggacgagccaacgctctcggtcccgcatcctcgggcgcat
caacgggccttcgtgctcgtcccttggctccaggtccagccgcaggcgcgcttggcggtc
ggcggcgaggacatttcggtccgcgagctcatcgcccagctcgcgcaggccgagcgggcc
tccgtgcgccacaccccgctcacgttgtccgcgttcaccgcgcacgtctcatga

DBGET integrated database retrieval system