KEGG   Segniliparus rotundus: Srot_0453Help
Entry
Srot_0453         CDS       T01238                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
srt  Segniliparus rotundus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Srot_0453
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Srot_0453
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Srot_0453
Enzymes [BR:srt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Srot_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(435138..435926)
Genome map
AA seq 262 aa AA seqDB search
MSVPNSSADVIAACQAEGRAALIGYLPAGYPDLKTSQRAFEILAEEGCDLLEIGVPYSDP
VMDGPVIESAAVAALTAGFRLKDLFPLVENLSKKDIPALVMTYWNPVFRYGVDRFADDLE
NAGGLGLITPNLIPEEAEAWFQASDRLNLDRVFLVAPSSTPERLILTTNSCRGFIYAAST
MGVTGARNDVSMDAAELVARVRKASGIAVGVGIGVSNGAAARYVAGYADAVIVGSALVAA
LGKGEDALRALVRELAEGVRGN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttcccaactcgtccgcggacgtcatcgccgcctgccaggcagagggccgcgcc
gccctcatcggataccttccggcgggctacccggacctgaaaacttcgcagcgcgccttc
gaaatcctcgccgaagaaggctgcgacctcctggagatcggcgtcccctactcggacccg
gtgatggacggcccggtgatcgaatcggccgccgtcgccgccctgacggcgggcttccgg
ctcaaagacctgttcccgctggtcgaaaacctcagcaaaaaagatatcccggccctggtc
atgacctactggaacccagtgttccgatacggcgtggaccgcttcgccgacgaccttgag
aacgcgggcggtctgggcctcatcacgccgaacctcatcccagaagaggccgaggcgtgg
ttccaagcctctgaccggttgaatttggaccgtgtcttcctcgtcgcgccgtcgtccacg
ccggagcggttgatcctcaccacgaactcgtgccggggcttcatctacgcggcttccacg
atgggggtgaccggggcccgcaacgacgtctccatggacgccgccgaacttgtcgcccgg
gtgcgcaaagccagcggcatcgccgtcggcgtcggcatcggcgtctccaatggcgcggcg
gctcgctatgtcgcgggctacgcggacgcggtgatcgtgggctctgcgctggtcgcggcg
ctcggcaagggcgaggacgcgttgcgcgcgctggtgcgcgaactcgccgaaggcgtgcgc
gggaactaa

DBGET integrated database retrieval system