KEGG   Segniliparus rotundus: Srot_0454Help
Entry
Srot_0454         CDS       T01238                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
srt  Segniliparus rotundus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Srot_0454
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Srot_0454
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Srot_0454
Enzymes [BR:srt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Srot_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(436007..437251)
Genome map
AA seq 414 aa AA seqDB search
MSPAQPLPTASEGVRVRTEHDPDAGGYFGRFGGRHVPEALMAVIEEVTDAYEKARVDEDY
LAQLDALQRDYVGRPSPLYEAKRLSEHAGGARILLKREDLNHTGSHKINNVLGQGLLAKK
MGKTRVIAETGAGQHGVATATACALLGLECVIYMGETDTERQSLNVARMRLLGAHVMAVK
TGSRTLKDAINAALRDWVTNAATTYYCFGTAAGPHPFPMMVRDLQRVVGLETRAQVREHV
GQLPDAVVACVGGGSNAIGIFDPFLRYRQVQLVGCEPAGDGVDTERHAATLGGGSEGVFQ
GSFSYLLQDQDGQTVESHSISAGLDYPGVGPQHAHLKETGRARYLPITDAQAMEAFDVLC
RTEGIIPAIESAHAVAGGLLLGRELGGGSVIVVNLSGRGDKDVDTAAKWFGMDL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgcgcaacccctcccgaccgcgagcgaaggggtccgtgtccgcacggagcac
gaccccgacgcggggggctacttcggccgtttcggcggacgccatgtgcccgaagcgctc
atggcagtgatcgaggaggtcaccgacgcctatgagaaggcacgggtggacgaggactac
ctcgcgcagctcgacgcgctgcaacgcgattatgtcggcagaccctcccccctgtacgag
gcgaaacggctctctgagcacgcgggcggggcgcgcatcctgctcaaacgggaggatttg
aaccacaccggctcgcacaagatcaacaacgtcctcggccaaggcctgttggcgaagaag
atgggcaagacgcgggtcatcgcggagaccggcgcgggacagcacggcgtcgccactgcg
accgcctgcgcgctgctgggcctggaatgcgtcatctacatgggcgaaacggacacggag
cgccagtcgctcaacgtggcgcggatgcgactgctcggcgcgcacgtcatggcggtgaag
accggctctcggacattgaaggacgcgatcaacgcggcgcttcgcgactgggtcaccaac
gccgccaccacgtattactgcttcggcaccgcggccgggccgcatcccttcccgatgatg
gtgcgcgacctgcagcgtgtcgtcgggctcgagacaagggcccaggtccgcgaacacgtc
ggacagctcccggacgccgtggtggcctgtgtcggcggcggcagcaacgccattgggatc
ttcgaccccttcctgcgctaccgccaagtgcagctcgtcggttgcgagcccgcaggcgac
ggcgtggacaccgagcggcacgccgcgacgctcggcgggggctcggagggcgtgttccaa
ggctccttctcgtacctgttgcaggaccaggacggccaaaccgtggaatcgcattccatc
tccgcagggctcgactaccccggagtcggcccgcagcacgcgcatttgaaagaaaccggc
cgggcccggtacctgccgatcacggacgcgcaggccatggaggccttcgacgtgctgtgc
cgcaccgaaggcatcattcccgccattgagtcggcgcacgccgtggccgggggcctcctg
ttgggccgagagctcggcgggggcagcgtcatcgtggtgaacctctccggccggggcgac
aaggacgtcgacaccgccgccaagtggttcgggatggatctgtaa

DBGET integrated database retrieval system